LXL04_025784 | RubberDandelionOmics

Gene overview

LXL04_025784

Reference: OH-1004 Chr: Chr05 Coordinates: 116870602-116876225 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1890 bp · LXL04_025784|LXL04_025784|OH1004|cDNA

ATGCCGTCTGTATCTGTAAAGCTCTACAGTGTTCTTCATAAATTCATTTTGAAACGCCAATTGCAAACCCTCAGTGAAACCCACACCAAAATCTTCAATCAATTCGGTGTCGTATCACGCCCCGATGAATCCGTCGCTCCGGCCAACCCTAGCTTCTCTGAAGACGGCGTCGCTACCAAAGATATCCATATTGATCCTTTGACATCTCTCACCCTCCGGATCTTTCTCCCCGATTCAGTACTTGCGAAATCAAGAGGGTT...

CDS

Download CDS FASTA

1890 bp · LXL04_025784|LXL04_025784|OH1004|CDS

ATGCCGTCTGTATCTGTAAAGCTCTACAGTGTTCTTCATAAATTCATTTTGAAACGCCAATTGCAAACCCTCAGTGAAACCCACACCAAAATCTTCAATCAATTCGGTGTCGTATCACGCCCCGATGAATCCGTCGCTCCGGCCAACCCTAGCTTCTCTGAAGACGGCGTCGCTACCAAAGATATCCATATTGATCCTTTGACATCTCTCACCCTCCGGATCTTTCTCCCCGATTCAGTACTTGCGAAATCAAGAGGGTT...

Protein

Download Protein FASTA

629 aa · LXL04_025784|LXL04_025784|OH1004|PROTEIN

MPSVSVKLYSVLHKFILKRQLQTLSETHTKIFNQFGVVSRPDESVAPANPSFSEDGVATKDIHIDPLTSLTLRIFLPDSVLAKSRGLNQGDGVYGGYSPALGDTLRKLPVVLQFHGGGFATGSNVSVANDLFCRRIAKACDAIVVAVGYRLAPESKYPAAFEDGVEALSWLAKQANLAECRISGRVDLRRRQIVDGFGSSMIEPWIAAHADLSRCVLLGVSSGSNIANYVTQKAVEAGNLLDPVRVVAQVLMYPFVIGNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025784`
TK1151 ID	TkA03G008120
OH-1004 ID	LXL04_025784
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	56.700
Protein coverage (%)	TK1151 96.957 / OH-1004 60.095 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025784

Location Chr05:116870602-116876225 (+)

Description Similar to CXE16: Probable carboxylesterase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14310`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g27320`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g63010`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x
`At3g05120`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025784 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048444 floral organ morphogenesis Biological Process

GO:0048530 fruit morphogenesis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1905516 positive regulation of fertilization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010331 gibberellin binding Molecular Function

KEGG gene cross-reference

ath:AT3G05120

ath:AT3G27320

ath:AT3G63010

ath:AT5G14310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · LXL04_025784 · OH-1004

Nucleus0.297

Rank 2 · LXL04_025784 · OH-1004

Cell membrane0.121

Rank 3 · LXL04_025784 · OH-1004

Endoplasmic reticulum0.101

Rank 4 · LXL04_025784 · OH-1004

Plastid0.100

Rank 5 · LXL04_025784 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20434.6BD-FAE106-176 aa

PF07859.20Abhydrolase_3111-357 aa

PF13966.12zf-RVT419-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025784	`PF20434.6`	BD-FAE	106	176	4.6e-08	33.5
LXL04_025784	`PF07859.20`	Abhydrolase_3	111	357	1.1e-55	189.4
LXL04_025784	`PF13966.12`	zf-RVT	419	486	2.3e-10	41.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LED9`	Arabidopsis thaliana	Probable carboxylesterase 16	61.060%	Swiss-Prot	moderate database homology
`Q9LK21`	Arabidopsis thaliana	Probable carboxylesterase 11	58.259%	Swiss-Prot	moderate database homology
`Q9LYC1`	Arabidopsis thaliana	Gibberellin receptor GID1B	31.361%	Swiss-Prot	moderate database homology
`Q9MAA7`	Arabidopsis thaliana	Gibberellin receptor GID1A	30.625%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card