LXL04_025777 | RubberDandelionOmics

Gene overview

LXL04_025777

Reference: OH-1004 Chr: Chr05 Coordinates: 116822894-116831444 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4554 bp · LXL04_025777|LXL04_025777|OH1004|cDNA

ATGGCGTCTGGTGATAGAAGAACCGCAGAAGAAAAAGCCATCGACGAATGGCTTCCAGTGACATCCTCCCGAAACGCAAAGTGGTGGTACTCAGCTTTCCACAATGTCACCGCCATGGTCGGCGCCGGCGTCCTCAGTCTCCCCTACGCTCTATCCCAACTCGGATGGGGATTCGGAATCACAGTACTCCTCCTCTCGTGGATAATCACCCTCTACACCCTCTGGCAAATGGTGGAAATGCACGAAATGGTTCCAGGAAA...

CDS

Download CDS FASTA

4554 bp · LXL04_025777|LXL04_025777|OH1004|CDS

ATGGCGTCTGGTGATAGAAGAACCGCAGAAGAAAAAGCCATCGACGAATGGCTTCCAGTGACATCCTCCCGAAACGCAAAGTGGTGGTACTCAGCTTTCCACAATGTCACCGCCATGGTCGGCGCCGGCGTCCTCAGTCTCCCCTACGCTCTATCCCAACTCGGATGGGGATTCGGAATCACAGTACTCCTCCTCTCGTGGATAATCACCCTCTACACCCTCTGGCAAATGGTGGAAATGCACGAAATGGTTCCAGGAAA...

Protein

Download Protein FASTA

1517 aa · LXL04_025777|LXL04_025777|OH1004|PROTEIN

MASGDRRTAEEKAIDEWLPVTSSRNAKWWYSAFHNVTAMVGAGVLSLPYALSQLGWGFGITVLLLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGTCIVYMVTGGKSLQKFQQSVCPDCKPLKTTYFILIFASVHFILAHLPNFNSISCVSLAAAIMSLSYSTIAWMASWNRGAHHGVDYSPRSKTPLGQMFGMFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWLGCVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025777`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025777

Location Chr05:116822894-116831444 (-)

Description Similar to LHT1: Lysine histidine transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40780`	Amino acid-proton symporter.	Arabidopsis LHT1 is a high-affinity transporter for cellular amino acid uptake in both root epidermis and leaf mesophyll.2006 · DOI: 10.1105/tpc.106.041012 Comprehensive screening of Arabidopsis mutants suggests the lysine histidine transporter 1 to be involved in plant uptake of amino acids.2007 · DOI: 10.1104/pp.106.092205 Root uptake of cationic amino acids by Arabidopsis depends on functional expression of amino acid permease 5.2008 · DOI: 10.1111/j.1469-8137.2008.02589.x LHT1, a lysine- and histidine-specific amino acid transporter in arabidopsis.1997 · DOI: 10.1104/pp.115.3.1127
`At1g24400`	Amino acid-proton symporter.	Selective expression of a novel high-affinity transport system for acidic and neutral amino acids in the tapetum cells of Arabidopsis flowers.2004 · DOI: 10.1111/j.1365-313x.2004.02186.x
`At1g48640`	Amino acid transporter.	No verified direct reference in this release
`At1g67640`	Amino acid transporter.	No verified direct reference in this release
`At1g33350`	Pentatricopeptide repeat-containing protein At1g33350.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025777 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006952 defense response Biological Process

GO:0016556 mRNA modification Biological Process

GO:0043090 amino acid import Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015172 acidic amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G24400

ath:AT1G33350

ath:AT1G48640

ath:AT1G67640

ath:AT5G40780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.322

Rank 1 · LXL04_025777 · OH-1004

Plastid0.187

Rank 2 · LXL04_025777 · OH-1004

Nucleus0.094

Rank 3 · LXL04_025777 · OH-1004

Golgi apparatus0.089

Rank 4 · LXL04_025777 · OH-1004

Cell membrane0.080

Rank 5 · LXL04_025777 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans25-420 aa

PF03222.20Trp_Tyr_perm31-182 aa

PF22062.3OB_DPOA2605-705 aa

PF04042.22DNA_pol_E_B745-942 aa

PF12854.14PPR_11155-1184 aa

PF13041.13PPR_21156-1188 aa

PF01535.27PPR1159-1187 aa

PF13041.13PPR_21188-1229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025777	`PF01490.25`	Aa_trans	25	420	1.9e-104	350.3
LXL04_025777	`PF03222.20`	Trp_Tyr_perm	31	182	5.1e-07	29.9
LXL04_025777	`PF22062.3`	OB_DPOA2	605	705	4.9e-23	81.9
LXL04_025777	`PF04042.22`	DNA_pol_E_B	745	942	3.8e-39	135.0
LXL04_025777	`PF12854.14`	PPR_1	1155	1184	4.4e-29	100.6
LXL04_025777	`PF13041.13`	PPR_2	1156	1188	2.9e-46	156.1
LXL04_025777	`PF01535.27`	PPR	1159	1187	4.2e-42	140.2
LXL04_025777	`PF13041.13`	PPR_2	1188	1229	2.9e-46	156.1
LXL04_025777	`PF01535.27`	PPR	1191	1219	4.2e-42	140.2
LXL04_025777	`PF13812.13`	PPR_3	1288	1335	4e-15	56.3
LXL04_025777	`PF13041.13`	PPR_2	1289	1336	2.9e-46	156.1
LXL04_025777	`PF01535.27`	PPR	1292	1320	4.2e-42	140.2
LXL04_025777	`PF29070.1`	MSC6_N	1293	1385	1.4e-07	31.7
LXL04_025777	`PF20431.5`	E_motif	1406	1468	5.8e-14	52.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKS8`	Arabidopsis thaliana	Lysine histidine transporter 1	74.217%	Swiss-Prot	weak database homology
`Q9LRB5`	Arabidopsis thaliana	Lysine histidine transporter 2	72.664%	Swiss-Prot	weak database homology
`Q9C733`	Arabidopsis thaliana	Lysine histidine transporter-like 1	68.396%	Swiss-Prot	weak database homology
`Q9SR44`	Arabidopsis thaliana	Lysine histidine transporter-like 2	73.494%	Swiss-Prot	weak database homology
`Q9C501`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g33350	52.416%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card