LXL04_025349 | RubberDandelionOmics

Gene overview

LXL04_025349

Reference: OH-1004 Chr: Chr05 Coordinates: 110230988-110231419 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_025349|LXL04_025349|OH1004|cDNA

ATGTGTAGAGAAGAAGGAATTGACCGGATCTTCGTGGATGCTGCTCACGCAATTGGGTCAATTAGGGTTGATGTCAAAGAAATTGGGGCTGATTTCTACACTAGCAACCTCCATAAATGGCTATTCTGTCCACCTTCAGTCGCATTCTTGTACTGTAAGAATCCAGTGCTATCTAATCTCCACCACCCCGTGGTATCTCATGAATACGAAAATGGGTTGGCCATAGAAAGTTCATGGATCGGCACAAGGGACTACAGTGC...

CDS

Download CDS FASTA

387 bp · LXL04_025349|LXL04_025349|OH1004|CDS

ATGTGTAGAGAAGAAGGAATTGACCGGATCTTCGTGGATGCTGCTCACGCAATTGGGTCAATTAGGGTTGATGTCAAAGAAATTGGGGCTGATTTCTACACTAGCAACCTCCATAAATGGCTATTCTGTCCACCTTCAGTCGCATTCTTGTACTGTAAGAATCCAGTGCTATCTAATCTCCACCACCCCGTGGTATCTCATGAATACGAAAATGGGTTGGCCATAGAAAGTTCATGGATCGGCACAAGGGACTACAGTGC...

Protein

Download Protein FASTA

128 aa · LXL04_025349|LXL04_025349|OH1004|PROTEIN

MCREEGIDRIFVDAAHAIGSIRVDVKEIGADFYTSNLHKWLFCPPSVAFLYCKNPVLSNLHHPVVSHEYENGLAIESSWIGTRDYSAQLVVPEALEFVNRFEGGLDGIKGVSQKDRPCNKVKPQGPVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025349`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025349

Location Chr05:110230988-110231419 (+)

Description Similar to Os01g0290100: Putative L-cysteine desulfhydrase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26600`	May catalyze the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release
`At3g62130`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0290100`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release
`Os01g0290600`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025349 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019450 L-cysteine catabolic process to pyruvate Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016829 lyase activity Molecular Function

GO:0016846 carbon-sulfur lyase activity Molecular Function

GO:0080146 L-cysteine desulfhydrase activity Molecular Function

KEGG gene cross-reference

aor:AO090026000291

ath:AT3G62130

ath:AT5G26600

dosa:Os01g0290100

dosa:Os01g0290600

osa:4325157

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · LXL04_025349 · OH-1004

Nucleus0.230

Rank 2 · LXL04_025349 · OH-1004

Peroxisome0.130

Rank 3 · LXL04_025349 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_025349 · OH-1004

Lysosome / Vacuole0.058

Rank 5 · LXL04_025349 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00266.26Aminotran_510-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025349	`PF00266.26`	Aminotran_5	10	65	4.6e-09	36.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E6S9`	Arabidopsis thaliana	Probable L-cysteine desulfhydrase, chloroplastic	75.000%	Swiss-Prot	strong database homology
`Q9M1R1`	Arabidopsis thaliana	L-cysteine desulfhydrase	73.394%	Swiss-Prot	strong database homology
`Q9LGZ2`	Oryza sativa subsp. japonica	Putative L-cysteine desulfhydrase 1	71.171%	Swiss-Prot	strong database homology
`Q5JNT6`	Oryza sativa subsp. japonica	Putative L-cysteine desulfhydrase 2	66.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card