LXL04_024485 | RubberDandelionOmics

Gene overview

LXL04_024485

Reference: OH-1004 Chr: Chr05 Coordinates: 91864134-91865300 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · LXL04_024485|LXL04_024485|OH1004|cDNA

ATGGCATTACAAAACATTGGTGCAAGCAACAGCGATGACGCCTTCTACAGATACAAAATGCCCAAAATGATAACCAAAATTGAAGGCCGTGGAAACGGCATCAAAACCAACATAGTCAACATGGTGGATGTTGCCAAAGCTTTAGCTCGCCCCCCTTCTTACACCACCAAATACTTCGGTACCGAACTCGGCGCCCAATCAAAATTCGATGAAAAAACCGGCGTGTCTTTAGTCAACGGGGCCCACGACACCTCCAAACT...

CDS

Download CDS FASTA

1167 bp · LXL04_024485|LXL04_024485|OH1004|CDS

ATGGCATTACAAAACATTGGTGCAAGCAACAGCGATGACGCCTTCTACAGATACAAAATGCCCAAAATGATAACCAAAATTGAAGGCCGTGGAAACGGCATCAAAACCAACATAGTCAACATGGTGGATGTTGCCAAAGCTTTAGCTCGCCCCCCTTCTTACACCACCAAATACTTCGGTACCGAACTCGGCGCCCAATCAAAATTCGATGAAAAAACCGGCGTGTCTTTAGTCAACGGGGCCCACGACACCTCCAAACT...

Protein

Download Protein FASTA

388 aa · LXL04_024485|LXL04_024485|OH1004|PROTEIN

MALQNIGASNSDDAFYRYKMPKMITKIEGRGNGIKTNIVNMVDVAKALARPPSYTTKYFGTELGAQSKFDEKTGVSLVNGAHDTSKLASLLENFIKKYVQCYGCGNPETEVLITKTQMVNLKCAACGFISDVDMRDKLTSFILKNPPEKKNAKDKKALRRAEKERIKEGEAADKSKISKKKMKEVSKPTDTSAEDDEDDVQWQTDTSAEAARQRVQEQLSAVTADMVMLLEEEVTKSPRQILVEKIKDDLDKGVGPDAMM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024485`
TK1151 ID	TkA03G104030
OH-1004 ID	LXL04_024485
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.300
Protein coverage (%)	TK1151 99.764 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024485

Location Chr05:91864134-91865300 (+)

Description Similar to EIF5: Eukaryotic translation initiation factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77840`	Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide.	No verified direct reference in this release
`At1g36730`	Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024485 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001732 formation of cytoplasmic translation initiation complex Biological Process

GO:0006446 regulation of translational initiation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0042255 ribosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

GO:0005092 GDP-dissociation inhibitor activity Molecular Function

GO:0005096 GTPase activator activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT1G36730

ath:AT1G77840

hsa:1983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.673

Rank 1 · LXL04_024485 · OH-1004

Cytoplasm0.426

Rank 2 · LXL04_024485 · OH-1004

Endoplasmic reticulum0.039

Rank 3 · LXL04_024485 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_024485 · OH-1004

Mitochondrion0.031

Rank 5 · LXL04_024485 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01873.24eIF-5_eIF-2B11-127 aa

PF02020.25W2310-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024485	`PF01873.24`	eIF-5_eIF-2B	11	127	4.1e-35	120.9
LXL04_024485	`PF02020.25`	W2	310	388	2.6e-22	79.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S825`	Arabidopsis thaliana	Probable eukaryotic translation initiation factor 5-2	59.767%	Swiss-Prot	strong database homology
`Q9C8F1`	Arabidopsis thaliana	Probable eukaryotic translation initiation factor 5-1	58.465%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card