LXL04_023871 | RubberDandelionOmics

Gene overview

LXL04_023871

Reference: OH-1004 Chr: Chr05 Coordinates: 72035292-72037170 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

831 bp · LXL04_023871|LXL04_023871|OH1004|cDNA

ATGGAGATTGGAGAATTGGAGACAAACGAACCGTCTTGCGCAAGAAACACGCAACGCGAAATCCATAAAAGGGTTTTTGGATCAATTGATTCGTTGATGATAGCTGGTTCTGCAAGTACTTCGAAGCGAAGAAGACTCACCACTACCGATCTTATGGAATCTCAAATTGCCAAGGAAAAACTCGCTGCAGCAAAGCAAAACTATGGAAGGGATATCCGCGTATTTGAGACAACAACATCCTCTCAAACATCAAATGAGCC...

CDS

Download CDS FASTA

831 bp · LXL04_023871|LXL04_023871|OH1004|CDS

ATGGAGATTGGAGAATTGGAGACAAACGAACCGTCTTGCGCAAGAAACACGCAACGCGAAATCCATAAAAGGGTTTTTGGATCAATTGATTCGTTGATGATAGCTGGTTCTGCAAGTACTTCGAAGCGAAGAAGACTCACCACTACCGATCTTATGGAATCTCAAATTGCCAAGGAAAAACTCGCTGCAGCAAAGCAAAACTATGGAAGGGATATCCGCGTATTTGAGACAACAACATCCTCTCAAACATCAAATGAGCC...

Protein

Download Protein FASTA

276 aa · LXL04_023871|LXL04_023871|OH1004|PROTEIN

MEIGELETNEPSCARNTQREIHKRVFGSIDSLMIAGSASTSKRRRLTTTDLMESQIAKEKLAAAKQNYGRDIRVFETTTSSQTSNEPTNDEEPDEFFEFTAEDYYRILATKKEDKVMKTKKLREAEEAARRSRITKAVIRVRFPDNHTLEATFHPSETMQNLIDLIIKVVARPDLPFHIFTTPPKKQIKDMSQDFYSAGFAPGAIVYFSYDEPKGNGDGDVAFLKEDVMALKGVEQEKPMVDQGTTEPVAVAAPPPVQER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023871`
TK1151 ID	TkA06G202560
OH-1004 ID	LXL04_023871
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.638 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023871

Location Chr05:72035292-72037170 (-)

Description Similar to PUX1: Plant UBX domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27310`	Regulates CDC48A by inhibiting its ATPase activity and by promoting the disassembly of the active hexamer.	Plant UBX domain-containing protein 1, PUX1, regulates the oligomeric structure and activity of arabidopsis CDC48.2004 · DOI: 10.1074/jbc.m405498200 Protein domain-domain interactions and requirements for the negative regulation of Arabidopsis CDC48/p97 by the plant ubiquitin regulatory X (UBX) domain-containing protein, PUX1.2007 · DOI: 10.1074/jbc.m609042200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023871 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000423 mitophagy Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0016236 macroautophagy Biological Process

GO:0031401 positive regulation of protein modification process Biological Process

GO:0032510 endosome to lysosome transport via multivesicular body sorting pathway Biological Process

GO:0032984 protein-containing complex disassembly Biological Process

GO:0035265 organ growth Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0043335 protein unfolding Biological Process

GO:0046324 regulation of D-glucose import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G27310

hsa:79058

hsa:80700

mmu:66530

mmu:68938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.716

Rank 1 · LXL04_023871 · OH-1004

Nucleus0.279

Rank 2 · LXL04_023871 · OH-1004

Endoplasmic reticulum0.066

Rank 3 · LXL04_023871 · OH-1004

Golgi apparatus0.060

Rank 4 · LXL04_023871 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_023871 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK22`	Arabidopsis thaliana	Plant UBX domain-containing protein 1	57.551%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card