LXL04_022497 | RubberDandelionOmics

Gene overview

LXL04_022497

Reference: OH-1004 Chr: Chr04 Coordinates: 151627974-151628420 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · LXL04_022497|LXL04_022497|OH1004|cDNA

ATGTCTTTGAAGATGAACTTTGATCTCATGCTTAATAAACATATTAACGTTAATGGGATCAAGATGACTACTATATCATGCAAAGTCAAAGAGCTGCCGATAGGTAGCAAAAAGAATCTGTACCAAGTTCTTTCATTGGAATCCCAGAATGTGAGTTTCCATGACCTCAAGAAAGCGTACCGGGCCAAAGCTCTTCAACTCCATCCCGATGTTTCTCCATTATCGATAAAGGAGGAATGCACAAAGCAGTTTGTGGAGTT...

CDS

Download CDS FASTA

447 bp · LXL04_022497|LXL04_022497|OH1004|CDS

ATGTCTTTGAAGATGAACTTTGATCTCATGCTTAATAAACATATTAACGTTAATGGGATCAAGATGACTACTATATCATGCAAAGTCAAAGAGCTGCCGATAGGTAGCAAAAAGAATCTGTACCAAGTTCTTTCATTGGAATCCCAGAATGTGAGTTTCCATGACCTCAAGAAAGCGTACCGGGCCAAAGCTCTTCAACTCCATCCCGATGTTTCTCCATTATCGATAAAGGAGGAATGCACAAAGCAGTTTGTGGAGTT...

Protein

Download Protein FASTA

148 aa · LXL04_022497|LXL04_022497|OH1004|PROTEIN

MSLKMNFDLMLNKHINVNGIKMTTISCKVKELPIGSKKNLYQVLSLESQNVSFHDLKKAYRAKALQLHPDVSPLSIKEECTKQFVELREAYEVLSDPNSRRLYDLSLVESMGCGAYNRDQRVQYSRMVWEMQLQGLKHRSEKRNVHFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022497`
TK1151 ID	TkA05G472150
OH-1004 ID	LXL04_022497
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 85.811 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022497

Location Chr04:151627974-151628420 (-)

Description Similar to ATJ20: Chaperone protein dnaJ 20, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13830`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022497 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000055 ribosomal large subunit export from nucleus Biological Process

GO:0006260 DNA replication Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006457 protein folding Biological Process

GO:0006897 endocytosis Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009408 response to heat Biological Process

GO:0010322 regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0042026 protein refolding Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:2001024 negative regulation of response to drug Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G13830

cgr:2889590

sce:YNL227C

tac:Ta1088

tvo:TVG0470348

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.719

Rank 1 · LXL04_022497 · OH-1004

Plastid0.205

Rank 2 · LXL04_022497 · OH-1004

Nucleus0.073

Rank 3 · LXL04_022497 · OH-1004

Cytoplasm0.052

Rank 4 · LXL04_022497 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_022497 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ39-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022497	`PF00226.37`	DnaJ	39	104	9.8e-18	64.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SDN0`	Arabidopsis thaliana	Chaperone protein dnaJ 20, chloroplastic	35.200%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card