LXL04_022227 | RubberDandelionOmics

Gene overview

LXL04_022227

Reference: OH-1004 Chr: Chr04 Coordinates: 146472405-146474217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1671 bp · LXL04_022227|LXL04_022227|OH1004|cDNA

ATGGAGGGTGCTGTTCGTTGTTCTGCAAATTACGTTCCTCTTTCACCAATAAGTTTTCTGGAACGAGCAGCTCGTGTTTATGGAGATAGAGTTTCCATTGTTTATGGGGATTACGTGAAGTTCACTTGGAAAGAGACTTATGAACGATGTGTTAAGCTTGCTTCTGCTTTAGTGACACACTTGGGAATATCTCACGGTGACATTGTGGCTGCATTGGCACCAAATGTTCCTGAGTTATACGAGTTACATTTTGGAGTTCC...

CDS

Download CDS FASTA

1671 bp · LXL04_022227|LXL04_022227|OH1004|CDS

ATGGAGGGTGCTGTTCGTTGTTCTGCAAATTACGTTCCTCTTTCACCAATAAGTTTTCTGGAACGAGCAGCTCGTGTTTATGGAGATAGAGTTTCCATTGTTTATGGGGATTACGTGAAGTTCACTTGGAAAGAGACTTATGAACGATGTGTTAAGCTTGCTTCTGCTTTAGTGACACACTTGGGAATATCTCACGGTGACATTGTGGCTGCATTGGCACCAAATGTTCCTGAGTTATACGAGTTACATTTTGGAGTTCC...

Protein

Download Protein FASTA

556 aa · LXL04_022227|LXL04_022227|OH1004|PROTEIN

MEGAVRCSANYVPLSPISFLERAARVYGDRVSIVYGDYVKFTWKETYERCVKLASALVTHLGISHGDIVAALAPNVPELYELHFGVPMAGGVLCNLNTRYDSKMVAILLEFSNAKVIFVDYEFLDVANEAIEILGEKSSYVPKIILIPESDKHLSMTKIPVTCDHNILEHKDLLALGSLGFEIKGPNDECDAIALSFTSGTTGNAKGVVYSHRGAYLNSLVVALIMEMPPMPVFLWSVPMFHCNGWCFAWAMAAQGGKNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022227`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022227

Location Chr04:146472405-146474217 (+)

Description Similar to AAE1: Probable acyl-activating enzyme 1, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20560`	Catalyzes the ligation of CoA on butanoate to produce butanoyl-CoA.	No verified direct reference in this release
`At2g17650`	Catalyzes the ligation of CoA on isovalerate to produce 3-methylbutanoyl-CoA.	No verified direct reference in this release
`At1g76290`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022227 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0016874 ligase activity Molecular Function

GO:0031956 medium-chain fatty acid-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20560

ath:AT1G76290

ath:AT2G17650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.551

Rank 1 · LXL04_022227 · OH-1004

Peroxisome0.176

Rank 2 · LXL04_022227 · OH-1004

Nucleus0.154

Rank 3 · LXL04_022227 · OH-1004

Plastid0.090

Rank 4 · LXL04_022227 · OH-1004

Mitochondrion0.078

Rank 5 · LXL04_022227 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding20-411 aa

PF13193.13AMP-binding_C462-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022227	`PF00501.35`	AMP-binding	20	411	6.3e-71	239.9
LXL04_022227	`PF13193.13`	AMP-binding_C	462	535	9e-19	68.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HUK6`	Arabidopsis thaliana	Butanoate--CoA ligase AAE1	58.942%	Swiss-Prot	strong database homology
`Q9SEY5`	Arabidopsis thaliana	Isovalerate--CoA ligase AAE2	54.234%	Swiss-Prot	strong database homology
`Q9SFW5`	Arabidopsis thaliana	Probable acyl-activating enzyme 21	53.902%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card