LXL04_022101 | RubberDandelionOmics

Gene overview

LXL04_022101

Reference: OH-1004 Chr: Chr04 Coordinates: 144659346-144660663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_022101|LXL04_022101|OH1004|cDNA

ATGTCTTTACAAGCTGAACCCTACCCCCAACTACTTAATTACATATACCAAAAAGGGGTGAAGCATTTGTGCGAGAACGGGCTAACACAAGTTCCGTACAAGTACATACTCCCCCTAAATGAAAGACCACAGACTTTAGTCGCTAATGGCTGCATCGAGTTACCCATTATCGATTTCCAGCAGCTCCAAACCATGGACAGACCCCAAATCCTTAAAACTCTATCTGAAGCTTGTCGGGAGTTCGGATTCTTCCAGGTGAC...

CDS

Download CDS FASTA

1059 bp · LXL04_022101|LXL04_022101|OH1004|CDS

ATGTCTTTACAAGCTGAACCCTACCCCCAACTACTTAATTACATATACCAAAAAGGGGTGAAGCATTTGTGCGAGAACGGGCTAACACAAGTTCCGTACAAGTACATACTCCCCCTAAATGAAAGACCACAGACTTTAGTCGCTAATGGCTGCATCGAGTTACCCATTATCGATTTCCAGCAGCTCCAAACCATGGACAGACCCCAAATCCTTAAAACTCTATCTGAAGCTTGTCGGGAGTTCGGATTCTTCCAGGTGAC...

Protein

Download Protein FASTA

352 aa · LXL04_022101|LXL04_022101|OH1004|PROTEIN

MSLQAEPYPQLLNYIYQKGVKHLCENGLTQVPYKYILPLNERPQTLVANGCIELPIIDFQQLQTMDRPQILKTLSEACREFGFFQVTNHGIEDEVIGKMIDVSKRFFELPFEERQRYMSNNLHEPVRYGTSFNQNNDGVFCWRDFLKLSCHPIEDFASLWPSSPVDLREAVGEYSTKTRHLYERVMEAIIESLGVRDEKSIVENGTQLMMVNCYPPCPEPELTLGLPPHSDYGLLTLLLQDQVEGLQIQHNGRWVTVKPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022101`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022101

Location Chr04:144659346-144660663 (+)

Description Similar to SLC1: Probable 2-oxoglutarate-dependent dioxygenase SLC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10500`	Converts salicylic acid (SA) to both 2,3-dihydroxybenzoic acid (2,3-DHBA) and 2,5-DHBA in vitro but only 2,3-DHBA in vivo.	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0560000`	Involved in the regulation of shoot development and salicylic acid (SA) homeostasis.	No verified direct reference in this release
`Os09g0570800`	Involved in the regulation of shoot development and salicylic acid (SA) homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022101 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G10490

ath:AT4G10500

dosa:Os08g0560000

dosa:Os09g0570800

osa:4346321

osa:4347916

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.793

Rank 1 · LXL04_022101 · OH-1004

Nucleus0.336

Rank 2 · LXL04_022101 · OH-1004

Peroxisome0.058

Rank 3 · LXL04_022101 · OH-1004

Mitochondrion0.053

Rank 4 · LXL04_022101 · OH-1004

Cell membrane0.039

Rank 5 · LXL04_022101 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N54-161 aa

PF03171.272OG-FeII_Oxy207-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022101	`PF14226.13`	DIOX_N	54	161	2.6e-30	106.2
LXL04_022101	`PF03171.27`	2OG-FeII_Oxy	207	301	9.6e-36	122.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSA7`	Arabidopsis thaliana	Protein DMR6-LIKE OXYGENASE 2	40.181%	Swiss-Prot	moderate database homology
`Q9ZSA8`	Arabidopsis thaliana	Protein DMR6-LIKE OXYGENASE 1	44.710%	Swiss-Prot	moderate database homology
`Q6YYX9`	Oryza sativa subsp. japonica	Probable 2-oxoglutarate-dependent dioxygenase SLC1	53.582%	Swiss-Prot	strong database homology
`Q651B6`	Oryza sativa subsp. japonica	Probable 2-oxoglutarate-dependent dioxygenase SLC2	47.714%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card