LXL04_021977 | RubberDandelionOmics

Gene overview

LXL04_021977

Reference: OH-1004 Chr: Chr04 Coordinates: 141727485-141730259 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2334 bp · LXL04_021977|LXL04_021977|OH1004|cDNA

ATGGTAGGAAAAGAAGATGAAGCTAGCGGGGACAGTAACACCATTGACAGTACTGGTTCACGACTGCATCATCCCATTCCAGGTAACAAAAAAATGTATTGGAGGTCTGCTTCATGGTCTTCTTCTCATGTATCATTACCACCACTCAATCCCGATAGTGTAAAAGACCCTTCAGATCCAAGCAACTCCGGGCAGATTCGAAGGTGTCCTGTCCCTCTAACTCCTAGATCATCAAACAGTAAAGGTCGTTCATTTCTCCC...

CDS

Download CDS FASTA

2334 bp · LXL04_021977|LXL04_021977|OH1004|CDS

ATGGTAGGAAAAGAAGATGAAGCTAGCGGGGACAGTAACACCATTGACAGTACTGGTTCACGACTGCATCATCCCATTCCAGGTAACAAAAAAATGTATTGGAGGTCTGCTTCATGGTCTTCTTCTCATGTATCATTACCACCACTCAATCCCGATAGTGTAAAAGACCCTTCAGATCCAAGCAACTCCGGGCAGATTCGAAGGTGTCCTGTCCCTCTAACTCCTAGATCATCAAACAGTAAAGGTCGTTCATTTCTCCC...

Protein

Download Protein FASTA

777 aa · LXL04_021977|LXL04_021977|OH1004|PROTEIN

MVGKEDEASGDSNTIDSTGSRLHHPIPGNKKMYWRSASWSSSHVSLPPLNPDSVKDPSDPSNSGQIRRCPVPLTPRSSNSKGRSFLPPLSIARRSLDEWPRAGSDDVGEWPIPSTPSGERLKLDLSSLQKIPDKNASLVKRDKIAFFDKKCSKVAEHIFLGGDAVARDKSILKQHKITHILNCVGFVCPEYFKGHFVYRTLWLQDSPSEDITSILYDVFDYFEDVRDQNGKVFVHCCQGVSRSTSLVIAYRMWREGQSFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021977`
TK1151 ID	TkA05G436670
OH-1004 ID	LXL04_021977
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.607 / OH-1004 98.842 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021977

Location Chr04:141727485-141730259 (+)

Description Similar to MKP1: Protein-tyrosine-phosphatase MKP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55270`	Protein-tyrosine-phosphatase that acts as a negative regulator of MPK6 and MPK3 signaling by dephosphorylating and repressing MPK6 and MPK3.	Mitogen-activated protein kinase phosphatase is required for genotoxic stress relief in Arabidopsis.2001 · DOI: 10.1101/gad.192601 Distinct regulation of salinity and genotoxic stress responses by Arabidopsis MAP kinase phosphatase 1.2002 · DOI: 10.1093/emboj/cdf646 The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067678 Arabidopsis MAP Kinase Phosphatase 1 (AtMKP1) negatively regulates MPK6-mediated PAMP responses and resistance against bacteria.2011 · DOI: 10.1111/j.1365-313x.2011.04588.x Arabidopsis MAP kinase phosphatase 1 is phosphorylated and activated by its substrate AtMPK6.2011 · DOI: 10.1007/s00299-011-1064-4 Arabidopsis MAP kinase phosphatase 1 and its target MAP kinases 3 and 6 antagonistically determine UV-B stress tolerance, independent of the UVR8 photoreceptor pathway.2011 · DOI: 10.1111/j.1365-313x.2011.04725.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021977 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007162 negative regulation of cell adhesion Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010225 response to UV-C Biological Process

GO:0032355 response to estradiol Biological Process

GO:0032526 response to retinoic acid Biological Process

GO:0032870 cellular response to hormone stimulus Biological Process

GO:0033574 response to testosterone Biological Process

KEGG gene cross-reference

ath:AT3G55270

hsa:1843

mmu:19252

rno:114856

xla:380262

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.649

Rank 1 · LXL04_021977 · OH-1004

Nucleus0.301

Rank 2 · LXL04_021977 · OH-1004

Cell membrane0.089

Rank 3 · LXL04_021977 · OH-1004

Golgi apparatus0.071

Rank 4 · LXL04_021977 · OH-1004

Mitochondrion0.055

Rank 5 · LXL04_021977 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782.26DSPc158-288 aa

PF25466.1MPK1_gelsolin_C675-768 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021977	`PF00782.26`	DSPc	158	288	3.2e-25	89.2
LXL04_021977	`PF25466.1`	MPK1_gelsolin_C	675	768	3.4e-23	82.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5S1`	Arabidopsis thaliana	Protein-tyrosine-phosphatase MKP1	50.181%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card