LXL04_021860 | RubberDandelionOmics

Gene overview

LXL04_021860

Reference: OH-1004 Chr: Chr04 Coordinates: 138764370-138769792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1398 bp · LXL04_021860|LXL04_021860|OH1004|cDNA

ATGACCGTCAACAACAATGTTATGAAGAATAAAACATTTAGCGTTTTCGATATGAGAATGTCATTTATGTGTGGTCAAAGATTTGCTGTAAACAACTGTTATTGTTTGGTTAGAGAGGATGGTTTCTACTTTGCTAAGGATGATAGAGTTTTTCCAGATGGTTGGCAATTTATAAAAATCATTGTTTTTACATTGCATATCATGAACCTTATAATCAAACATCGGTTTCTTATTATTGTTCTATTCAACCTCTTGGTCTT...

CDS

Download CDS FASTA

1398 bp · LXL04_021860|LXL04_021860|OH1004|CDS

ATGACCGTCAACAACAATGTTATGAAGAATAAAACATTTAGCGTTTTCGATATGAGAATGTCATTTATGTGTGGTCAAAGATTTGCTGTAAACAACTGTTATTGTTTGGTTAGAGAGGATGGTTTCTACTTTGCTAAGGATGATAGAGTTTTTCCAGATGGTTGGCAATTTATAAAAATCATTGTTTTTACATTGCATATCATGAACCTTATAATCAAACATCGGTTTCTTATTATTGTTCTATTCAACCTCTTGGTCTT...

Protein

Download Protein FASTA

465 aa · LXL04_021860|LXL04_021860|OH1004|PROTEIN

MTVNNNVMKNKTFSVFDMRMSFMCGQRFAVNNCYCLVREDGFYFAKDDRVFPDGWQFIKIIVFTLHIMNLIIKHRFLIIVLFNLLVLIGGGYVFPKAGNRKRSNYLDLYAVYITNGDIDNLMAHCKSKDDDIGDKKLTPNQYFHWIFRQNFLLTTLFACTFRSMTPDNKELKHATFNVFDIQLSILCGDEYSINRCYWLVRNDGFYFSRDDDKTFPDGWIYFTSSLRVLSRYFAQTRGDTFYFTNIMSFTTKHYSFIIIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021860`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021860

Location Chr04:138764370-138769792 (+)

Description Similar to SPH6: S-protein homolog 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05825`	S-protein homolog 6.	No verified direct reference in this release
`At5g26060`	S-protein homolog 12.	No verified direct reference in this release
`At4g16295`	S-protein homolog 1.	No verified direct reference in this release
`At4g29035`	S-protein homolog 74.	No verified direct reference in this release
`At5g06030`	S-protein homolog 28.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021860 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009875 pollen-pistil interaction Biological Process

GO:0060320 rejection of self pollen Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT4G16295

ath:AT5G26060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.356

Rank 1 · LXL04_021860 · OH-1004

Lysosome / Vacuole0.221

Rank 2 · LXL04_021860 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_021860 · OH-1004

Endoplasmic reticulum0.163

Rank 4 · LXL04_021860 · OH-1004

Cell membrane0.158

Rank 5 · LXL04_021860 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938.18Self-incomp_S1112-213 aa

PF05938.18Self-incomp_S1298-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021860	`PF05938.18`	Self-incomp_S1	112	213	7.7e-45	152.5
LXL04_021860	`PF05938.18`	Self-incomp_S1	298	393	7.7e-45	152.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F2Q9V4`	Arabidopsis thaliana	S-protein homolog 6	31.852%	Swiss-Prot	weak database homology
`Q680N1`	Arabidopsis thaliana	S-protein homolog 12	34.921%	Swiss-Prot	weak database homology
`F4JLS0`	Arabidopsis thaliana	S-protein homolog 1	31.818%	Swiss-Prot	weak database homology
`Q2HQ46`	Arabidopsis thaliana	S-protein homolog 74	39.000%	Swiss-Prot	weak database homology
`Q9FI83`	Arabidopsis thaliana	S-protein homolog 28	34.831%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card