LXL04_019904 | RubberDandelionOmics

Gene overview

LXL04_019904

Reference: OH-1004 Chr: Chr04 Coordinates: 43863370-43866675 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3147 bp · LXL04_019904|LXL04_019904|OH1004|cDNA

ATGACGACGATGATTAGGGTTTTATTACTTGCTATGTTCATCATTCCTGCTATAAGTCAGCTTCCTTCCCAAGATATTTTAGCGTTACTCGAATTTAAAAAAGGAATCAAACATGACCCAACTGGGTTCGTTCTAAATTCCTGGAACGAAGAGTCCATCGACTTCAATGGCTGCCCATCTTCCTGGAATGGAATCATGTGCAATGGTGGTAACGTTGCTGGTGTGGTCCTCAACCATCTGTCGCTGTCAGCGGACATTGA...

CDS

Download CDS FASTA

3147 bp · LXL04_019904|LXL04_019904|OH1004|CDS

ATGACGACGATGATTAGGGTTTTATTACTTGCTATGTTCATCATTCCTGCTATAAGTCAGCTTCCTTCCCAAGATATTTTAGCGTTACTCGAATTTAAAAAAGGAATCAAACATGACCCAACTGGGTTCGTTCTAAATTCCTGGAACGAAGAGTCCATCGACTTCAATGGCTGCCCATCTTCCTGGAATGGAATCATGTGCAATGGTGGTAACGTTGCTGGTGTGGTCCTCAACCATCTGTCGCTGTCAGCGGACATTGA...

Protein

Download Protein FASTA

1048 aa · LXL04_019904|LXL04_019904|OH1004|PROTEIN

MTTMIRVLLLAMFIIPAISQLPSQDILALLEFKKGIKHDPTGFVLNSWNEESIDFNGCPSSWNGIMCNGGNVAGVVLNHLSLSADIDLNVFANLTKLVTLSISNNSISGKFPSKLGGMLAFLDISDNLFNSSLPPDIGKMNSLMNLSLAGNSFSGSIPDWISGLSSLKSLDFSRNLFSGPIPPSITTLNNIVYLNLSMNGLTKKIPKGFQDMVALEALDVHGNMLEGDFDPEFLLFTTAIHVDFSGNLLTSSNKDGKFLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019904`
TK1151 ID	TkA05G103900
OH-1004 ID	LXL04_019904
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.200
Protein coverage (%)	TK1151 96.520 / OH-1004 89.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019904

Location Chr04:43863370-43866675 (+)

Description Similar to GHR1: LRR receptor-like serine/threonine-protein kinase GHR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20940`	Receptor kinase acting as an early component in abscisic acid (ABA) signaling.	A plasma membrane receptor kinase, GHR1, mediates abscisic acid- and hydrogen peroxide-regulated stomatal movement in Arabidopsis.2012 · DOI: 10.1105/tpc.112.100107 A Dominant Mutation in the HT1 Kinase Uncovers Roles of MAP Kinases and GHR1 in CO2-Induced Stomatal Closure.2016 · DOI: 10.1105/tpc.16.00131 Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514 The Receptor-like Pseudokinase GHR1 Is Required for Stomatal Closure.2018 · DOI: 10.1105/tpc.18.00441
`At5g10020`	Probable inactive receptor kinase At5g10020.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At4g36180`	Probable LRR receptor-like serine/threonine-protein kinase At4g36180.	No verified direct reference in this release
`At3g28040`	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019904 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009745 sucrose mediated signaling Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0030154 cell differentiation Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0071485 cellular response to absence of light Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1905392 plant organ morphogenesis Biological Process

KEGG gene cross-reference

ath:AT3G28040

ath:AT4G20940

ath:AT4G36180

ath:AT5G10020

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.878

Rank 1 · LXL04_019904 · OH-1004

Endoplasmic reticulum0.075

Rank 2 · LXL04_019904 · OH-1004

Cytoplasm0.066

Rank 3 · LXL04_019904 · OH-1004

Nucleus0.048

Rank 4 · LXL04_019904 · OH-1004

Extracellular0.023

Rank 5 · LXL04_019904 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_223-68 aa

PF23598.2LRR_1478-171 aa

PF13855.13LRR_8122-176 aa

PF13855.13LRR_8186-225 aa

PF13855.13LRR_8430-489 aa

PF13855.13LRR_8503-562 aa

PF07714.24PK_Tyr_Ser-Thr769-967 aa

PF00069.32Pkinase769-968 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019904	`PF08263.18`	LRRNT_2	23	68	4e-09	37.3
LXL04_019904	`PF23598.2`	LRR_14	78	171	9.8e-19	68.0
LXL04_019904	`PF13855.13`	LRR_8	122	176	2.2e-41	140.1
LXL04_019904	`PF13855.13`	LRR_8	186	225	2.2e-41	140.1
LXL04_019904	`PF13855.13`	LRR_8	430	489	2.2e-41	140.1
LXL04_019904	`PF13855.13`	LRR_8	503	562	2.2e-41	140.1
LXL04_019904	`PF07714.24`	PK_Tyr_Ser-Thr	769	967	9.4e-27	94.7
LXL04_019904	`PF00069.32`	Pkinase	769	968	2.1e-23	83.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ9`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GHR1	65.377%	Swiss-Prot	strong database homology
`Q0WR59`	Arabidopsis thaliana	Probable inactive receptor kinase At5g10020	39.388%	Swiss-Prot	moderate database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	31.724%	Swiss-Prot	moderate database homology
`C0LGS2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	28.751%	Swiss-Prot	weak database homology
`Q9LRT1`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	30.684%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card