LXL04_019393 | RubberDandelionOmics

Gene overview

LXL04_019393

Reference: OH-1004 Chr: Chr04 Coordinates: 30311697-30312670 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · LXL04_019393|LXL04_019393|OH1004|cDNA

ATGATCAGTGATCATACCAGAAAAATGGAAGAAGAAAAAAGATCCGGCGTCGTAAGCAGGTTCTTAGGAGAACTAAACATCACCGTGAGACGATTCCTGTTTCGAGTCATGTCATCTGGTCCAATCCCACAACACATCGCCTTCATCATGGATGGAAACCGAAGGTTTGCGAAAAAATGGAAGCTCGAAGAAGGTGCAGGCCATAAAGCGGGATTCCTAGCCCTCATGTCGTTGCTAAAATACTGCTATGAGATGGGAGT...

CDS

Download CDS FASTA

861 bp · LXL04_019393|LXL04_019393|OH1004|CDS

ATGATCAGTGATCATACCAGAAAAATGGAAGAAGAAAAAAGATCCGGCGTCGTAAGCAGGTTCTTAGGAGAACTAAACATCACCGTGAGACGATTCCTGTTTCGAGTCATGTCATCTGGTCCAATCCCACAACACATCGCCTTCATCATGGATGGAAACCGAAGGTTTGCGAAAAAATGGAAGCTCGAAGAAGGTGCAGGCCATAAAGCGGGATTCCTAGCCCTCATGTCGTTGCTAAAATACTGCTATGAGATGGGAGT...

Protein

Download Protein FASTA

286 aa · LXL04_019393|LXL04_019393|OH1004|PROTEIN

MISDHTRKMEEEKRSGVVSRFLGELNITVRRFLFRVMSSGPIPQHIAFIMDGNRRFAKKWKLEEGAGHKAGFLALMSLLKYCYEMGVKYVTVYAFSLDNFNRRPDEVQYVMDLMHEKIEGFMKELDMVNRYGIRVLFIGDLNRLYAPVRVAAEKAMEATAKNTKTYLLVCVAYTSSHEIPRAVYEACQERSGRKDGKEEEEEEEEELIKVVDLEKKMYMGVVPDPDILVRSSGETRLSNFLLWQTSNSLLYSPKALWPEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019393`
TK1151 ID	TkA05G048860
OH-1004 ID	LXL04_019393
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019393

Location Chr04:30311697-30312670 (+)

Description Similar to At2g17570: Dehydrodolichyl diphosphate synthase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17570`	Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.	No verified direct reference in this release
`At5g60510`	Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.	No verified direct reference in this release
`At5g60500`	Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019393 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016094 polyprenol biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004659 prenyltransferase activity Molecular Function

GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Molecular Function

GO:0045547 ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific] activity Molecular Function

GO:0050267 rubber cis-polyprenylcistransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G17570

ath:AT5G60500

ath:AT5G60510

sly:101253666

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.546

Rank 1 · LXL04_019393 · OH-1004

Mitochondrion0.160

Rank 2 · LXL04_019393 · OH-1004

Cytoplasm0.137

Rank 3 · LXL04_019393 · OH-1004

Nucleus0.097

Rank 4 · LXL04_019393 · OH-1004

Peroxisome0.069

Rank 5 · LXL04_019393 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01255.25Prenyltransf49-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019393	`PF01255.25`	Prenyltransf	49	278	2.2e-66	224.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S2T1`	Arabidopsis thaliana	Dehydrodolichyl diphosphate synthase 6	56.738%	Swiss-Prot	strong database homology
`Q8LAR7`	Arabidopsis thaliana	Dehydrodolichyl diphosphate synthase 8	48.519%	Swiss-Prot	moderate database homology
`Q8LED0`	Arabidopsis thaliana	Dehydrodolichyl diphosphate synthase 7	49.027%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card