LXL04_019068 | RubberDandelionOmics

Gene overview

LXL04_019068

Reference: OH-1004 Chr: Chr04 Coordinates: 23067997-23070752 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · LXL04_019068|LXL04_019068|OH1004|cDNA

ATGGTTGCCATTCTTCACATCTCTTCCCTTCAATCTAACATTCCACCGTTCCCACTCCCTTCCCTCACACCATCTCCGCCCTCCCTCCGCCATAGCTCCCTCAAATCGAAGGCGCACGTCGACATCCTTCTCCAAAGAAGAAAGAGACCGATAGCCTTTACCTGCCAATCCACCAATGACGATGGCGATGATGGTTATTTGTTGGACGCCCCTGTTTCCGTTGGAGACGGCTTCTCCTTTAGCGGAGGGAAATATTCGGA...

CDS

Download CDS FASTA

1221 bp · LXL04_019068|LXL04_019068|OH1004|CDS

ATGGTTGCCATTCTTCACATCTCTTCCCTTCAATCTAACATTCCACCGTTCCCACTCCCTTCCCTCACACCATCTCCGCCCTCCCTCCGCCATAGCTCCCTCAAATCGAAGGCGCACGTCGACATCCTTCTCCAAAGAAGAAAGAGACCGATAGCCTTTACCTGCCAATCCACCAATGACGATGGCGATGATGGTTATTTGTTGGACGCCCCTGTTTCCGTTGGAGACGGCTTCTCCTTTAGCGGAGGGAAATATTCGGA...

Protein

Download Protein FASTA

406 aa · LXL04_019068|LXL04_019068|OH1004|PROTEIN

MVAILHISSLQSNIPPFPLPSLTPSPPSLRHSSLKSKAHVDILLQRRKRPIAFTCQSTNDDGDDGYLLDAPVSVGDGFSFSGGKYSDGPNPADEWFKTGKYMKAHPVYGTGEKAKDPIFGLTMGGNSQTSKDLFRWFCVESGNVDKPTVVLIHGFPSQAYSYRKVLPQLSKDYHTIAFDWLGFGYSDKPQPKYGFDYTLDEFVSALGSVIDELGVDKVSLVVQGYFAPIVVKYASNHQEKVNDLILLNPPLTAKHANLPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019068`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019068`
Location	Chr04:23067997-23070752 (-)
Description	Similar to ceeh-1: Epoxide hydrolase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019068` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0018786 haloalkane dehalogenase activity Molecular Function
KEGG gene cross-reference	cel:CELE_K02F3.6 mbo:BQ2027_MB1864C mtc:MT1881 mtu:Rv1833c mtv:RVBD_1833c son:SO_1743 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_019068 · OH-1004

Mitochondrion0.030

Rank 2 · LXL04_019068 · OH-1004

Cytoplasm0.021

Rank 3 · LXL04_019068 · OH-1004

Nucleus0.019

Rank 4 · LXL04_019068 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_019068 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146.16Hydrolase_4146-375 aa

PF00561.27Abhydrolase_1147-387 aa

PF12697.14Abhydrolase_6149-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019068	`PF12146.16`	Hydrolase_4	146	375	4e-09	36.9
LXL04_019068	`PF00561.27`	Abhydrolase_1	147	387	3.2e-23	83.4
LXL04_019068	`PF12697.14`	Abhydrolase_6	149	386	2.8e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card