RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_018876
Reference: OH-1004 Chr: Chr04 Coordinates: 19510323-19511957 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1362 bp · LXL04_018876|LXL04_018876|OH1004|cDNA

ATGCAGATGAATTCTATCGATCCAACAATATTCAGATCATCTACAATGGCAACTGTCTCGGCCTTCTCTTCTCCGGAATGgccaaaccctaaccctaaccCTAGTACAAGCGACAATACACGTTCAGAAGAAGACAAAGAAAATCCTAATTCACTTGCCGGTGACCTTCACAGCGGTGTCTCGCCGGGGCTCCAACCGATCAGAACGAGTTCCACCCAACAAGGAATTTTACCCGATCACGATGCTAAAGAAGATATTGA...

CDS

Download CDS FASTA

1362 bp · LXL04_018876|LXL04_018876|OH1004|CDS

ATGCAGATGAATTCTATCGATCCAACAATATTCAGATCATCTACAATGGCAACTGTCTCGGCCTTCTCTTCTCCGGAATGGCCAAACCCTAACCCTAACCCTAGTACAAGCGACAATACACGTTCAGAAGAAGACAAAGAAAATCCTAATTCACTTGCCGGTGACCTTCACAGCGGTGTCTCGCCGGGGCTCCAACCGATCAGAACGAGTTCCACCCAACAAGGAATTTTACCCGATCACGATGCTAAAGAAGATATTGA...

Protein

Download Protein FASTA

453 aa · LXL04_018876|LXL04_018876|OH1004|PROTEIN

MQMNSIDPTIFRSSTMATVSAFSSPEWPNPNPNPSTSDNTRSEEDKENPNSLAGDLHSGVSPGLQPIRTSSTQQGILPDHDAKEDIDAANQPNSAPVTVPVPGQTLIPSSNIKIPNLSLFHVSFNQDNGCFACGINQGFRIYNCDPFREIFRRDFDYGGGIGIVEMLFRCNILALVGGGPQPQYPLNKVMIWDDHQGRCIGELSFRSEVRGVRLRRDRIIVILEQKIFVYNFTDLKLLQQIETFANPKGLCEVSQASGNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_018876
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_018876
LocationChr04:19510323-19511957 (+)
DescriptionSimilar to ATG18A: Autophagy-related protein 18a
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g62770 May act as a PI(3,5)P₂ regulatory-complex component in phosphatidylinositol 3,5-bisphosphate synthesis and turnover.
Autophagy differentially controls plant basal immunity to biotrophic and necrotrophic pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04546.x
A critical role of autophagy in plant resistance to necrotrophic fungal pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04553.x
The autophagy gene, ATG18a, plays a negative role in powdery mildew resistance and mildew-induced cell death in Arabidopsis.2011 · DOI: 10.4161/psb.6.9.16967
At3g56440 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release
At2g40810 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release
At5g05150 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018876 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000045 autophagosome assembly Biological Process
GO:0000422 autophagy of mitochondrion Biological Process
GO:0000425 pexophagy Biological Process
GO:0006914 autophagy Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009267 cellular response to starvation Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010508 positive regulation of autophagy Biological Process
GO:0015031 protein transport Biological Process
KEGG gene cross-reference
ath:AT2G40810
ath:AT3G56440
ath:AT3G62770
ath:AT5G05150
xtr:493546
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.523
Rank 1 · LXL04_018876 · OH-1004
Nucleus0.257
Rank 2 · LXL04_018876 · OH-1004
Cell membrane0.169
Rank 3 · LXL04_018876 · OH-1004
Lysosome / Vacuole0.163
Rank 4 · LXL04_018876 · OH-1004
Golgi apparatus0.152
Rank 5 · LXL04_018876 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21032.3PROPPIN121-370 aa
PF25174.2Beta-prop_THOC3187-363 aa
PF24814.2WD40_Prp19188-360 aa
PF24807.2WD40_CDC20-Fz216-381 aa
PF25171.2Beta-prop_WDR36-Utp21_1st217-350 aa
PF25173.2Beta-prop_WDR3_1st226-363 aa
PF24817.2WD40_WDHD1_1st234-358 aa
PF12894.14ANAPC4_WD40262-332 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_018876PF21032.3PROPPIN1213706.7e-33115.0
LXL04_018876PF25174.2Beta-prop_THOC31873631.3e-1557.8
LXL04_018876PF24814.2WD40_Prp191883607.1e-0935.8
LXL04_018876PF24807.2WD40_CDC20-Fz2163813.3e-1040.5
LXL04_018876PF25171.2Beta-prop_WDR36-Utp21_1st2173509.5e-0832.5
LXL04_018876PF25173.2Beta-prop_WDR3_1st2263631.8e-0835.0
LXL04_018876PF24817.2WD40_WDHD1_1st2343581.4e-0938.3
LXL04_018876PF12894.14ANAPC4_WD402623321.1e-0732.7
LXL04_018876PF23414.2Beta-prop_EML_22703647.3e-1142.6
LXL04_018876PF21034.4BCAS3_WD402863651.1e-1454.6
LXL04_018876PF25175.2Beta-prop_WDR52873642.8e-1144.0
LXL04_018876PF23381.2Beta-prop_IFT122_1st2873631.6e-1041.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93VB2Arabidopsis thalianaAutophagy-related protein 18a62.857%Swiss-Protstrong database homology
Q0WPK3Arabidopsis thalianaAutophagy-related protein 18d58.592%Swiss-Protstrong database homology
Q8GYD7Arabidopsis thalianaAutophagy-related protein 18c54.381%Swiss-Protstrong database homology
Q9FHK8Arabidopsis thalianaAutophagy-related protein 18e44.745%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser