LXL04_018423 | RubberDandelionOmics

Gene overview

LXL04_018423

Reference: OH-1004 Chr: Chr04 Coordinates: 12712803-12714694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1536 bp · LXL04_018423|LXL04_018423|OH1004|cDNA

ATGATACCAATTGAAGGGCTCCAGGTACTTTTTCACTTTCACATTAATATTCTCCAAAACCTCCACCACCCCCGTCCGCCGCAACCCTTTCTCACTCCTTTCACTTTCACAACCATGACCTTCAGCTCCGTGAAGCTAGACGCAAACCCTACCGCATCGGCGTTCAGGTCCCTCAACGGAGCATGTCGGAGCAACACCACCACCGGCCTTCGTCCCGTGTTTTTTCACCACCACTCCCACCACCGAAAAAATGCTTCAAT...

CDS

Download CDS FASTA

1536 bp · LXL04_018423|LXL04_018423|OH1004|CDS

ATGATACCAATTGAAGGGCTCCAGGTACTTTTTCACTTTCACATTAATATTCTCCAAAACCTCCACCACCCCCGTCCGCCGCAACCCTTTCTCACTCCTTTCACTTTCACAACCATGACCTTCAGCTCCGTGAAGCTAGACGCAAACCCTACCGCATCGGCGTTCAGGTCCCTCAACGGAGCATGTCGGAGCAACACCACCACCGGCCTTCGTCCCGTGTTTTTTCACCACCACTCCCACCACCGAAAAAATGCTTCAAT...

Protein

Download Protein FASTA

511 aa · LXL04_018423|LXL04_018423|OH1004|PROTEIN

MIPIEGLQVLFHFHINILQNLHHPRPPQPFLTPFTFTTMTFSSVKLDANPTASAFRSLNGACRSNTTTGLRPVFFHHHSHHRKNASISCSASPITTLEDTKGEIPSRIGSLGQVSGVLGCQWGDEGKGKLVDILAKHFDVVARCQGGANAGHTIYNSEGKKFALHLVPSGILNDDTMCVIGNGVVVHLPGLFKEIDSLESNGVSCNGRILVSDRAHLLFDYHQEIDGLREAELAKSFIGTTKRGIGPCYSSKVIRNGIRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018423`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018423

Location Chr04:12712803-12714694 (-)

Description Similar to PURA: Adenylosuccinate synthetase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57610`	Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018423 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0044208 'de novo' AMP biosynthetic process Biological Process

GO:0046040 IMP metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004019 adenylosuccinate synthase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G57610

nta:107819886

rcu:8278953

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.747

Rank 1 · LXL04_018423 · OH-1004

Mitochondrion0.301

Rank 2 · LXL04_018423 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_018423 · OH-1004

Nucleus0.039

Rank 4 · LXL04_018423 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_018423 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00709.28Adenylsucc_synt117-459 aa

PF00709.28Adenylsucc_synt457-509 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018423	`PF00709.28`	Adenylsucc_synt	117	459	1.8e-167	558.1
LXL04_018423	`PF00709.28`	Adenylsucc_synt	457	509	1.8e-167	558.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96529`	Arabidopsis thaliana	Adenylosuccinate synthetase, chloroplastic	73.092%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card