LXL04_016923 | RubberDandelionOmics

Gene overview

LXL04_016923

Reference: OH-1004 Chr: Chr03 Coordinates: 136926445-136939498 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4908 bp · LXL04_016923|LXL04_016923|OH1004|cDNA

ATGGGGACCGGATTCAGATCTGGGTGTCGTTTACTGATTATAATCGCGGTTTGTATAATAGTCTGTGGCTACTCGGTTTCAGCAGAGACTCAACGACCCAAGAATGTACAAGTTGCTCTTCGTGCCAAATGGCCTGGAACCTCACTCCTCCTCGAAGCCGGTGAACTACTATCTAAACAATGGAAAGACCTTTTCTGGGAATTCATCGAATCATGGATTAACAACGAAAGTGGAAACATAGATCCTTACACAGCCAAAGA...

CDS

Download CDS FASTA

4908 bp · LXL04_016923|LXL04_016923|OH1004|CDS

ATGGGGACCGGATTCAGATCTGGGTGTCGTTTACTGATTATAATCGCGGTTTGTATAATAGTCTGTGGCTACTCGGTTTCAGCAGAGACTCAACGACCCAAGAATGTACAAGTTGCTCTTCGTGCCAAATGGCCTGGAACCTCACTCCTCCTCGAAGCCGGTGAACTACTATCTAAACAATGGAAAGACCTTTTCTGGGAATTCATCGAATCATGGATTAACAACGAAAGTGGAAACATAGATCCTTACACAGCCAAAGA...

Protein

Download Protein FASTA

1635 aa · LXL04_016923|LXL04_016923|OH1004|PROTEIN

MGTGFRSGCRLLIIIAVCIIVCGYSVSAETQRPKNVQVALRAKWPGTSLLLEAGELLSKQWKDLFWEFIESWINNESGNIDPYTAKDCLQKISNYGKSLVTGPLASLFELSLTLRSSSPRLVLYQQLAEESLSSFPLSDDINPSPGGKCCWVDTGGALFFDVPELQSWLRDPHKNGDGFQQPELFDFDHVHFDSSNGSPIAILYGALGTDCFKEFHRTLVEAAKEGKVKYVLRPVLPSGCESKTGHCGAIGTKDPVNLGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016923`
TK1151 ID	TkA02G092710
OH-1004 ID	LXL04_016923
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 93.548 / OH-1004 21.284 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016923

Location Chr03:136926445-136939498 (+)

Description Similar to UGGT: UDP-glucose:glycoprotein glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71220`	Recognizes glycoproteins with minor folding defects.	Allele-specific suppression of a defective brassinosteroid receptor reveals a physiological role of UGGT in ER quality control.2007 · DOI: 10.1016/j.molcel.2007.05.015 Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR.2009 · DOI: 10.1073/pnas.0905532106 Receptor quality control in the endoplasmic reticulum for plant innate immunity.2009 · DOI: 10.1038/emboj.2009.263

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016923 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009306 protein secretion Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0046283 anthocyanin-containing compound metabolic process Biological Process

GO:0051084 'de novo' post-translational protein folding Biological Process

GO:1904380 endoplasmic reticulum mannose trimming Biological Process

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G71220

dme:Dmel_CG6850

hsa:56886

mmu:320011

rno:171129

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.695

Rank 1 · LXL04_016923 · OH-1004

Golgi apparatus0.251

Rank 2 · LXL04_016923 · OH-1004

Cytoplasm0.093

Rank 3 · LXL04_016923 · OH-1004

Nucleus0.081

Rank 4 · LXL04_016923 · OH-1004

Cell membrane0.047

Rank 5 · LXL04_016923 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18400.8Thioredoxin_1247-243 aa

PF18401.8Thioredoxin_13331-446 aa

PF18402.8Thioredoxin_14459-721 aa

PF18403.8Thioredoxin_15741-979 aa

PF06427.18UDP-g_GGTase1140-1239 aa

PF18404.8Glyco_transf_241295-1517 aa

PF01501.27Glyco_transf_81306-1421 aa

PF18404.8Glyco_transf_241520-1588 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016923	`PF18400.8`	Thioredoxin_12	47	243	5.8e-50	170.5
LXL04_016923	`PF18401.8`	Thioredoxin_13	331	446	1.7e-34	119.3
LXL04_016923	`PF18402.8`	Thioredoxin_14	459	721	2e-60	205.6
LXL04_016923	`PF18403.8`	Thioredoxin_15	741	979	1.1e-38	134.1
LXL04_016923	`PF06427.18`	UDP-g_GGTase	1140	1239	5.3e-27	94.7
LXL04_016923	`PF18404.8`	Glyco_transf_24	1295	1517	5.4e-136	453.0
LXL04_016923	`PF01501.27`	Glyco_transf_8	1306	1421	2.2e-06	28.1
LXL04_016923	`PF18404.8`	Glyco_transf_24	1520	1588	5.4e-136	453.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WL80`	Arabidopsis thaliana	UDP-glucose:glycoprotein glucosyltransferase	67.766%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card