Gene Card
Gene overview
cDNA / CDS / Protein Sequences
513 bp · LXL04_014839|LXL04_014839|OH1004|cDNA
ATGAGAGTGGGAAGATTGAAGAGTAGCATAGGACCCATAGTATACAAGCATGGGGGTAAATTGGCACATCAGGGATGTGTAAATACTATTGCTTGGAACTCAAAACGCTCACTATTGATATCTGGATCTGATGACACCCGTGTAAATGTTTGGAGTTATGAAAGCCGCAAGCTTCTGCAATCCATTGAGAGTGGCCATACTTTAAACATATTATGTACCAAGTTTGTTCCTGAAACATGTGATGATTTCGTAGCATCTGG...
513 bp · LXL04_014839|LXL04_014839|OH1004|CDS
ATGAGAGTGGGAAGATTGAAGAGTAGCATAGGACCCATAGTATACAAGCATGGGGGTAAATTGGCACATCAGGGATGTGTAAATACTATTGCTTGGAACTCAAAACGCTCACTATTGATATCTGGATCTGATGACACCCGTGTAAATGTTTGGAGTTATGAAAGCCGCAAGCTTCTGCAATCCATTGAGAGTGGCCATACTTTAAACATATTATGTACCAAGTTTGTTCCTGAAACATGTGATGATTTCGTAGCATCTGG...
Protein
Download Protein FASTA170 aa · LXL04_014839|LXL04_014839|OH1004|PROTEIN
MRVGRLKSSIGPIVYKHGGKLAHQGCVNTIAWNSKRSLLISGSDDTRVNVWSYESRKLLQSIESGHTLNILCTKFVPETCDDFVASGAADTEVRLFNLSRTQEDCNITPSALFQCHTRRVKKLAVEPGNPNVVWSASEDGTLRQHDLREVTSCPPAGECRNILGTRLGPD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014839 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014839 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr03:57856931-57858157 (+) | ||||||
| Description | Similar to ASG2: Protein ALTERED SEED GERMINATION 2 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006006 glucose metabolic process Biological Process GO:0008361 regulation of cell size Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032869 cellular response to insulin stimulus Biological Process GO:0035264 multicellular organism growth Biological Process GO:0045717 negative regulation of fatty acid biosynthetic process Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0047484 regulation of response to osmotic stress Biological Process GO:0055082 intracellular chemical homeostasis Biological Process | ||||||
| KEGG gene cross-reference | ath:AT5G10940 hsa:23038 hsa:55827 mmu:230796 mmu:74106 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25168.2Beta-prop_WDR36-Utp21_2nd17-148 aaPF25175.2Beta-prop_WDR522-149 aaPF00400.39WD4022-52 aaPF25173.2Beta-prop_WDR3_1st22-146 aaPF24807.2WD40_CDC20-Fz22-101 aaPF25172.2Beta-prop_WDR3_2nd22-102 aaPF24805.2EIF3I22-150 aaPF25174.2Beta-prop_THOC323-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014839 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 17 | 148 | 4.3e-07 | 30.2 |
| LXL04_014839 | PF25175.2 | Beta-prop_WDR5 | 22 | 149 | 3.2e-18 | 66.7 |
| LXL04_014839 | PF00400.39 | WD40 | 22 | 52 | 1.1e-14 | 54.8 |
| LXL04_014839 | PF25173.2 | Beta-prop_WDR3_1st | 22 | 146 | 5.4e-14 | 53.0 |
| LXL04_014839 | PF24807.2 | WD40_CDC20-Fz | 22 | 101 | 1.4e-11 | 45.0 |
| LXL04_014839 | PF25172.2 | Beta-prop_WDR3_2nd | 22 | 102 | 7.9e-07 | 29.3 |
| LXL04_014839 | PF24805.2 | EIF3I | 22 | 150 | 7.7e-06 | 26.0 |
| LXL04_014839 | PF25174.2 | Beta-prop_THOC3 | 23 | 101 | 1.7e-21 | 77.2 |
| LXL04_014839 | PF24796.2 | WDR55 | 23 | 149 | 1.1e-06 | 28.6 |
| LXL04_014839 | PF24814.2 | WD40_Prp19 | 25 | 150 | 4.9e-16 | 59.3 |
| LXL04_014839 | PF23381.2 | Beta-prop_IFT122_1st | 26 | 141 | 4.6e-12 | 46.6 |
| LXL04_014839 | PF24817.2 | WD40_WDHD1_1st | 27 | 103 | 2.6e-11 | 43.9 |
| LXL04_014839 | PF24807.2 | WD40_CDC20-Fz | 72 | 152 | 1.4e-11 | 45.0 |
| LXL04_014839 | PF24817.2 | WD40_WDHD1_1st | 81 | 149 | 2.6e-11 | 43.9 |
| LXL04_014839 | PF25174.2 | Beta-prop_THOC3 | 83 | 150 | 1.7e-21 | 77.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94BQ3 | Arabidopsis thaliana | Protein ALTERED SEED GERMINATION 2 | 73.154% | Swiss-Prot | strong database homology |