Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2454 bp · LXL04_014407|LXL04_014407|OH1004|cDNA
CTGGCTTTGTAGACGATTCTGTCAGATTATTCGTCTTCCGAACACCTAGAGAGTGGATGTACACTATGAGAGCCGATAAAAATGGTATCTTTAATCCAGAATTTCAACAACATGTCAAATACTTCTTGGATTTTGCATACACTAATGCAAATAACATTAGAAGTAAAAATGTGGAAGGGGAGACGGTTTTGCAAATCAGATGTCCGTGTTCCGAATGCAAAAATCGTTGTTACAAGAAGAGAGAGATGGTTGCGTATGAC...
2136 bp · LXL04_014407|LXL04_014407|OH1004|CDS
ATGTACACTATGAGAGCCGATAAAAATGGTATCTTTAATCCAGAATTTCAACAACATGTCAAATACTTCTTGGATTTTGCATACACTAATGCAAATAACATTAGAAGTAAAAATGTGGAAGGGGAGACGGTTTTGCAAATCAGATGTCCGTGTTCCGAATGCAAAAATCGTTGTTACAAGAAGAGAGAGATGGTTGCGTATGACATATATTACCATGGATTCATGGGAAATTATTCAATATGGTATGCGCATGGTGAATC...
Protein
Download Protein FASTA711 aa · LXL04_014407|LXL04_014407|OH1004|PROTEIN
MYTMRADKNGIFNPEFQQHVKYFLDFAYTNANNIRSKNVEGETVLQIRCPCSECKNRCYKKREMVAYDIYYHGFMGNYSIWYAHGESFPTHEVGECSNPIPSQHVGQRIDHEMAQDIDGEMDQDIDCGMDQDTDSEMDQDPNQTAEAFYALLRQSDVLLWDGFEKASKLSTTTRLLNWKSDCIVSDSAYDKLLPIFKDSMPDGAKLPTNFYETKKILKPLELPSEQIHVCLNHCMLFYGRDSDLDHCRICNESRYDERGK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014407 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014407 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:48542100-48547982 (-) | |||||||||
| Description | Similar to ASHH2: Histone-lysine N-methyltransferase ASHH2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0001763 morphogenesis of a branching structure Biological Process GO:0006281 DNA repair Biological Process GO:0006298 mismatch repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010038 response to metal ion Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G76710 ath:AT1G77300 hsa:29072 mmu:235626 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13963.12Transpos_assoc11-86 aaPF02992.21Transposase_21300-379 aaPF03004.20Transposase_24379-446 aaPF17907.8AWS650-684 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014407 | PF13963.12 | Transpos_assoc | 11 | 86 | 1.3e-11 | 45.2 |
| LXL04_014407 | PF02992.21 | Transposase_21 | 300 | 379 | 1.5e-27 | 97.0 |
| LXL04_014407 | PF03004.20 | Transposase_24 | 379 | 446 | 7.4e-11 | 43.1 |
| LXL04_014407 | PF17907.8 | AWS | 650 | 684 | 4.2e-14 | 53.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.