LXL04_013949 | RubberDandelionOmics

Gene overview

LXL04_013949

Reference: OH-1004 Chr: Chr03 Coordinates: 38986508-38988420 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_013949|LXL04_013949|OH1004|cDNA

ATGGAAGAAGCAGCGAAGCTGGAAAAGTTCATGGATTGGGCAACTACTCTCGGAGTTTCAGATTCTCCCTTTATTAATGTCGACGAAGAAGAACCGCAGAAACCTGGTCTTCGTCAGACGCCTTGTTGCCTAGGACAATCTCTCACTATATCCTATTTCCCTAATGCCGGCGGGAGAGGATTATGTGCATCACGCGATCTTCAGAAAGGCCGATTGATACTCAAAGTTCCAAAATCAGCTCTAATGACCTCACAAAGCCT...

CDS

Download CDS FASTA

1440 bp · LXL04_013949|LXL04_013949|OH1004|CDS

ATGGAAGAAGCAGCGAAGCTGGAAAAGTTCATGGATTGGGCAACTACTCTCGGAGTTTCAGATTCTCCCTTTATTAATGTCGACGAAGAAGAACCGCAGAAACCTGGTCTTCGTCAGACGCCTTGTTGCCTAGGACAATCTCTCACTATATCCTATTTCCCTAATGCCGGCGGGAGAGGATTATGTGCATCACGCGATCTTCAGAAAGGCCGATTGATACTCAAAGTTCCAAAATCAGCTCTAATGACCTCACAAAGCCT...

Protein

Download Protein FASTA

479 aa · LXL04_013949|LXL04_013949|OH1004|PROTEIN

MEEAAKLEKFMDWATTLGVSDSPFINVDEEEPQKPGLRQTPCCLGQSLTISYFPNAGGRGLCASRDLQKGRLILKVPKSALMTSQSLMMNDHNLSMSISKFSLSSNQILTVSLLNEVAKGKRSWWYPYLTQFPSNYDILASFNHFEMQALQLDDAIWAAEKALEKTKTEWKNATPVMEELMFKPHYLSFKAWIWASASISSRTMHIPWDPAGCFCPVGDFFNYAAPEDEQDVCEGVNEKQMDVKSTRLTDGVFEDDYDAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013949`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013949

Location Chr03:38986508-38988420 (+)

Description Similar to SDG40: Protein SET DOMAIN GROUP 40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17240`	Protein SET DOMAIN GROUP 40.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013949 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008218 bioluminescence Biological Process

GO:0018021 peptidyl-histidine methylation Biological Process

GO:0030047 actin modification Biological Process

GO:0032259 methylation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0070472 regulation of uterine smooth muscle contraction Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

KEGG gene cross-reference

ath:AT5G17240

mmu:52690

rno:299295

xtr:549331

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.662

Rank 1 · LXL04_013949 · OH-1004

Cytoplasm0.251

Rank 2 · LXL04_013949 · OH-1004

Plastid0.079

Rank 3 · LXL04_013949 · OH-1004

Cell membrane0.038

Rank 4 · LXL04_013949 · OH-1004

Mitochondrion0.035

Rank 5 · LXL04_013949 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856.34SET58-279 aa

PF09273.17Rubis-subs-bind327-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013949	`PF00856.34`	SET	58	279	2.3e-06	28.7
LXL04_013949	`PF09273.17`	Rubis-subs-bind	327	395	6.3e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQJ8`	Arabidopsis thaliana	Protein SET DOMAIN GROUP 40	49.489%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card