LXL04_012337 | RubberDandelionOmics

Gene overview

LXL04_012337

Reference: OH-1004 Chr: Chr03 Coordinates: 10551615-10557157 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2043 bp · LXL04_012337|LXL04_012337|OH1004|cDNA

ATGTTCAAACGACGAAGACACAAGTTTTTTCTTGAGATAATGGAGGCGATCATTGCGTATCAAAAGCGGGAAGGAGTGTACCTGGCTAATAGCATAGATAATCGTGTAAATTTCTATCAGCCTTATCTTCAAAGGAGCATCTGGAATTCACGGAAATGGATAATGAAATTGCACGCGTTGAAAACAAAATTCAATAGCGACAGTGCTCCAAATgaggatgttgaaaagaaggATGTCGAATTGTTGAAGAAGATTTGGGG...

CDS

Download CDS FASTA

2043 bp · LXL04_012337|LXL04_012337|OH1004|CDS

ATGTTCAAACGACGAAGACACAAGTTTTTTCTTGAGATAATGGAGGCGATCATTGCGTATCAAAAGCGGGAAGGAGTGTACCTGGCTAATAGCATAGATAATCGTGTAAATTTCTATCAGCCTTATCTTCAAAGGAGCATCTGGAATTCACGGAAATGGATAATGAAATTGCACGCGTTGAAAACAAAATTCAATAGCGACAGTGCTCCAAATGAGGATGTTGAAAAGAAGGATGTCGAATTGTTGAAGAAGATTTGGGG...

Protein

Download Protein FASTA

680 aa · LXL04_012337|LXL04_012337|OH1004|PROTEIN

MFKRRRHKFFLEIMEAIIAYQKREGVYLANSIDNRVNFYQPYLQRSIWNSRKWIMKLHALKTKFNSDSAPNEDVEKKDVELLKKIWGFTFNVANLCGIGCKFVNSFTFNDLNSISNLEITIKTWALAAMESNQEPNGEEEKTNFWPVSEEIDRGEIFREHSDDVFVLKLSPMNIIGPHYSVIKEESKTIRHLSSFIEKSEKPKEKGRKKKKKKTITGRRRRKREEEEGVWRSRHRGSSEDDVFKRAQALANILHTQGFKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012337`
TK1151 ID	TkA01G008490
OH-1004 ID	LXL04_012337
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 33.333 / OH-1004 5.441 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012337

Location Chr03:10551615-10557157 (-)

Description Similar to UGT76G1: UDP-glycosyltransferase 76G1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11340`	Glycosylates the amino acid-related molecules isoleucic acid (2-hydroxy-3-methylpentanoic acid) and valic acid (2-hydroxy-3- methylbutyric acid).	The Arabidopsis glucosyltransferase UGT76B1 conjugates isoleucic acid and modulates plant defense and senescence.2011 · DOI: 10.1105/tpc.111.088443
`At5g05880`	UDP-glycosyltransferase 76C4.	No verified direct reference in this release
`At5g05900`	UDP-glycosyltransferase 76C3.	No verified direct reference in this release
`At5g05890`	UDP-glycosyltransferase 76C5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0010150 leaf senescence Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0046527 glucosyltransferase activity Molecular Function

GO:0050139 nicotinate-N-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11340

ath:AT5G05880

ath:AT5G05890

ath:AT5G05900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · LXL04_012337 · OH-1004

Nucleus0.287

Rank 2 · LXL04_012337 · OH-1004

Endoplasmic reticulum0.088

Rank 3 · LXL04_012337 · OH-1004

Cell membrane0.081

Rank 4 · LXL04_012337 · OH-1004

Plastid0.072

Rank 5 · LXL04_012337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT304-650 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012337	`PF00201.25`	UDPGT	304	650	3.3e-34	119.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C768`	Arabidopsis thaliana	UDP-glycosyltransferase 76B1	48.636%	Swiss-Prot	moderate database homology
`Q9FI98`	Arabidopsis thaliana	UDP-glycosyltransferase 76C4	44.419%	Swiss-Prot	moderate database homology
`Q9FI96`	Arabidopsis thaliana	UDP-glycosyltransferase 76C3	46.050%	Swiss-Prot	moderate database homology
`Q9FI97`	Arabidopsis thaliana	UDP-glycosyltransferase 76C5	45.824%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card