LXL04_011835 | RubberDandelionOmics

Gene overview

LXL04_011835

Reference: OH-1004 Chr: Chr03 Coordinates: 1256332-1257930 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1599 bp · LXL04_011835|LXL04_011835|OH1004|cDNA

ATGGAATACAACAGGGATGCAGCCATTAAGGCAAAGAAACTAGCTGAGAAGAAATTGGGTGATAAAGATTTTGCAAGTGCAAAGAAATACGCATTAAAGGCCCAAACCCTGTACCCAGATCTTGATGGCATCTCTCTGTTGTCCACCATTGCTGACGTGTATATATCTGCAGAGAAGAAGGTAAGTGGTGAAGCTGACTGGTATGGGATACTCGGGGCAAACCctggtgatgatgatgatacAATAAAAAAACAGTACAG...

CDS

Download CDS FASTA

1599 bp · LXL04_011835|LXL04_011835|OH1004|CDS

ATGGAATACAACAGGGATGCAGCCATTAAGGCAAAGAAACTAGCTGAGAAGAAATTGGGTGATAAAGATTTTGCAAGTGCAAAGAAATACGCATTAAAGGCCCAAACCCTGTACCCAGATCTTGATGGCATCTCTCTGTTGTCCACCATTGCTGACGTGTATATATCTGCAGAGAAGAAGGTAAGTGGTGAAGCTGACTGGTATGGGATACTCGGGGCAAACCCTGGTGATGATGATGATACAATAAAAAAACAGTACAG...

Protein

Download Protein FASTA

532 aa · LXL04_011835|LXL04_011835|OH1004|PROTEIN

MEYNRDAAIKAKKLAEKKLGDKDFASAKKYALKAQTLYPDLDGISLLSTIADVYISAEKKVSGEADWYGILGANPGDDDDTIKKQYRKLALMLHPDKNKCVGADGAFQLVSQAWTLLSDKGKRRGRPAPDTFWTVCHGCKMQYEYLKVYLDQTLLCPNCHNPFLAKQSAPPHNLNHQYHSSLSNNRDRFWIPETDPSIASKAANVIQRVNERLKREREQLSPGYGLPCKNRKTEMPIPNRSGNNNTTRELTVFETRKILV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011835`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011835

Location Chr03:1256332-1257930 (+)

Description Similar to ATJ49: Chaperone protein dnaJ 49

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49060`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011835 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0071218 cellular response to misfolded protein Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0030544 Hsp70 protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G49060

bta:533603

hsa:54788

mmu:56709

xla:380336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.843

Rank 1 · LXL04_011835 · OH-1004

Cytoplasm0.181

Rank 2 · LXL04_011835 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_011835 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_011835 · OH-1004

Plastid0.016

Rank 5 · LXL04_011835 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ66-124 aa

PF23551.1Zn_ribbon_20132-165 aa

PF11926.14DUF3444298-506 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011835	`PF00226.37`	DnaJ	66	124	1.9e-18	67.0
LXL04_011835	`PF23551.1`	Zn_ribbon_20	132	165	3.2e-17	63.0
LXL04_011835	`PF11926.14`	DUF3444	298	506	3e-75	253.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH28`	Arabidopsis thaliana	Chaperone protein dnaJ 49	29.936%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card