LXL04_011146 | RubberDandelionOmics

Gene overview

LXL04_011146

Reference: OH-1004 Chr: Chr02 Coordinates: 158922959-158927087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2367 bp · LXL04_011146|LXL04_011146|OH1004|cDNA

ATGGCTCCTGTTTTGAGTAGAAGTTTAACCACGGCTTCTGTAGCCTCACTCCCTTACTCTCCACTCTTTTCATCTAAAACCAATACCCAGAATCGCTTATCTTTGAGAAGTGCGTTTTTGCATCAAAATGGATTGAAAAACAACAACTTTTCTTGCTCTGGGTTAAAGTGGAAAGTCGACAAAAGGGGTAATAGTGTCGTAGTGAAGTGCGAGGCTTCCGCAGTTGCTGAAAAAGAAGCCCCGGAGGAGGCTTCCGGCGA...

CDS

Download CDS FASTA

2367 bp · LXL04_011146|LXL04_011146|OH1004|CDS

ATGGCTCCTGTTTTGAGTAGAAGTTTAACCACGGCTTCTGTAGCCTCACTCCCTTACTCTCCACTCTTTTCATCTAAAACCAATACCCAGAATCGCTTATCTTTGAGAAGTGCGTTTTTGCATCAAAATGGATTGAAAAACAACAACTTTTCTTGCTCTGGGTTAAAGTGGAAAGTCGACAAAAGGGGTAATAGTGTCGTAGTGAAGTGCGAGGCTTCCGCAGTTGCTGAAAAAGAAGCCCCGGAGGAGGCTTCCGGCGA...

Protein

Download Protein FASTA

788 aa · LXL04_011146|LXL04_011146|OH1004|PROTEIN

MAPVLSRSLTTASVASLPYSPLFSSKTNTQNRLSLRSAFLHQNGLKNNNFSCSGLKWKVDKRGNSVVVKCEASAVAEKEAPEEASGEKHEYQAEVSRLMNLIVHSLYSHKEIFLRELVSNASDALDKLRFSSVTDPSLLGDAGELEIRIKPDPEKGTITISDTGIGMTREELIDCLGTIAQSGTSKFLSALKENKDLGNDNSLIGQFGVGFYSAFLVAEKVIVSTKSPRSDKQYIWEAAADSSSYVIREETDPEKQIRRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011146`
TK1151 ID	TkA03G568690
OH-1004 ID	LXL04_011146
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011146

Location Chr02:158922959-158927087 (+)

Description Similar to HSP90-5: Heat shock protein 90-5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04030`	Molecular chaperone required for chloroplast biogenesis.	The chlorate-resistant and photomorphogenesis-defective mutant cr88 encodes a chloroplast-targeted HSP90.2003 · DOI: 10.1046/j.1365-313x.2003.016011.x
`At3g07770`	Molecular chaperone which stabilizes unfolding protein intermediates and functions as a folding molecular chaperone that assists the non-covalent folding of proteins in an ATP-dependent manner.	No verified direct reference in this release
`At4g24190`	May have a molecular chaperone role in the processing of secreted materials.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011146 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006457 protein folding Biological Process

GO:0009306 protein secretion Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010157 response to chlorate Biological Process

GO:0030177 positive regulation of Wnt signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G04030

ath:AT3G07770

ath:AT4G24190

dre:30591

rno:362862

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.930

Rank 1 · LXL04_011146 · OH-1004

Mitochondrion0.084

Rank 2 · LXL04_011146 · OH-1004

Cytoplasm0.028

Rank 3 · LXL04_011146 · OH-1004

Nucleus0.025

Rank 4 · LXL04_011146 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_011146 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518.32HATPase_c112-269 aa

PF13589.13HATPase_c_3128-253 aa

PF00183.24HSP90274-768 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011146	`PF02518.32`	HATPase_c	112	269	2.1e-07	32.1
LXL04_011146	`PF13589.13`	HATPase_c_3	128	253	9.6e-10	39.3
LXL04_011146	`PF00183.24`	HSP90	274	768	9.2e-191	636.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIF2`	Arabidopsis thaliana	Heat shock protein 90-5, chloroplastic	79.367%	Swiss-Prot	strong database homology
`F4JFN3`	Arabidopsis thaliana	Heat shock protein 90-6, mitochondrial	69.527%	Swiss-Prot	strong database homology
`Q9STX5`	Arabidopsis thaliana	Endoplasmin homolog	44.231%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card