LXL04_010864 | RubberDandelionOmics

Gene overview

LXL04_010864

Reference: OH-1004 Chr: Chr02 Coordinates: 154462127-154464088 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1797 bp · LXL04_010864|LXL04_010864|OH1004|cDNA

ATGCGGATCATCTCCTCCAAATTTATCTTTCGCGCCCACACTCTGAccatgatgatgatgatgatgatgcttCCTTTTATGTTAGCAACCTCATGTCCTACTGATATCCAAAGGCCAAATATGTGTAAGATTGGATTCTGTTGCGACAATGGAAGTGTAGTTAGGCTAACCATTAATACTTGTGATGGAAGTGACCTGAAAAATGTAAACTTTTCTTCATTCCCGGGCCTTGAGAGACTGTTTATTGAAAAAAGTCATAT...

CDS

Download CDS FASTA

1797 bp · LXL04_010864|LXL04_010864|OH1004|CDS

ATGCGGATCATCTCCTCCAAATTTATCTTTCGCGCCCACACTCTGACCATGATGATGATGATGATGATGCTTCCTTTTATGTTAGCAACCTCATGTCCTACTGATATCCAAAGGCCAAATATGTGTAAGATTGGATTCTGTTGCGACAATGGAAGTGTAGTTAGGCTAACCATTAATACTTGTGATGGAAGTGACCTGAAAAATGTAAACTTTTCTTCATTCCCGGGCCTTGAGAGACTGTTTATTGAAAAAAGTCATAT...

Protein

Download Protein FASTA

598 aa · LXL04_010864|LXL04_010864|OH1004|PROTEIN

MRIISSKFIFRAHTLTMMMMMMMLPFMLATSCPTDIQRPNMCKIGFCCDNGSVVRLTINTCDGSDLKNVNFSSFPGLERLFIEKSHIEGNILHQIGLLHNLIDIYLWQNYVKGTFPVSFTNLTRLKYLYLSENNFNGTFPVLFNNLIRLKHLDLCRNNFNSKFFVSFTNLTRLEQLYISHNAFSGTFPLSFVNLTQLQYVNISQNSGTPPASFIGLTKLQHLYLSCNNFSSTFPLSFTNLTRLEYLDLSRNNFSGTFPLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010864`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010864

Location Chr02:154462127-154464088 (-)

Description Similar to GSO2: LRR receptor-like serine/threonine-protein kinase GSO2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010864 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0048226 Casparian strip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G44700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.755

Rank 1 · LXL04_010864 · OH-1004

Endoplasmic reticulum0.094

Rank 2 · LXL04_010864 · OH-1004

Cytoplasm0.086

Rank 3 · LXL04_010864 · OH-1004

Lysosome / Vacuole0.059

Rank 4 · LXL04_010864 · OH-1004

Extracellular0.052

Rank 5 · LXL04_010864 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1482-233 aa

PF13855.13LRR_8100-159 aa

PF13855.13LRR_8124-182 aa

PF13855.13LRR_8148-205 aa

PF13855.13LRR_8209-253 aa

PF12799.14LRR_4217-257 aa

PF23598.2LRR_14238-320 aa

PF13855.13LRR_8242-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010864	`PF23598.2`	LRR_14	82	233	1.5e-32	113.5
LXL04_010864	`PF13855.13`	LRR_8	100	159	1e-51	173.3
LXL04_010864	`PF13855.13`	LRR_8	124	182	1e-51	173.3
LXL04_010864	`PF13855.13`	LRR_8	148	205	1e-51	173.3
LXL04_010864	`PF13855.13`	LRR_8	209	253	1e-51	173.3
LXL04_010864	`PF12799.14`	LRR_4	217	257	2.6e-42	142.6
LXL04_010864	`PF23598.2`	LRR_14	238	320	1.5e-32	113.5
LXL04_010864	`PF13855.13`	LRR_8	242	301	1e-51	173.3
LXL04_010864	`PF12799.14`	LRR_4	265	303	2.6e-42	142.6
LXL04_010864	`PF12799.14`	LRR_4	289	329	2.6e-42	142.6
LXL04_010864	`PF13855.13`	LRR_8	308	349	1e-51	173.3
LXL04_010864	`PF12799.14`	LRR_4	313	351	2.6e-42	142.6
LXL04_010864	`PF23598.2`	LRR_14	333	393	1.5e-32	113.5
LXL04_010864	`PF12799.14`	LRR_4	361	399	2.6e-42	142.6
LXL04_010864	`PF13855.13`	LRR_8	362	421	1e-51	173.3
LXL04_010864	`PF23598.2`	LRR_14	382	489	1.5e-32	113.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	33.138%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	34.172%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	31.660%	Swiss-Prot	moderate database homology
`Q0JA29`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase FLS2	34.452%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card