LXL04_010300 | RubberDandelionOmics

Gene overview

LXL04_010300

Reference: OH-1004 Chr: Chr02 Coordinates: 143893750-143898295 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_010300|LXL04_010300|OH1004|cDNA

ATGGTTTCAGGAATCCCTAAATCCGCTCCTCCATTTACCAGCGACACCAACTCCAGTTCCATACCTGCTTTCTTCTCTGTTGTCACCACCAAATCCGCTCACCCCCGATCCTTCAACGGCGCCGATTTCTTAAAATCGAAGCCTTCCCTTTGTGGTTTTCCTTCTCTGCTTCTCCTCCTCCGATCCCGAATACCGCCATCTAGGACAAAATATGGACTAGATGATAATACAGTTGATTTCATCGAGCATGCATTGGCACT...

CDS

Download CDS FASTA

927 bp · LXL04_010300|LXL04_010300|OH1004|CDS

ATGGTTTCAGGAATCCCTAAATCCGCTCCTCCATTTACCAGCGACACCAACTCCAGTTCCATACCTGCTTTCTTCTCTGTTGTCACCACCAAATCCGCTCACCCCCGATCCTTCAACGGCGCCGATTTCTTAAAATCGAAGCCTTCCCTTTGTGGTTTTCCTTCTCTGCTTCTCCTCCTCCGATCCCGAATACCGCCATCTAGGACAAAATATGGACTAGATGATAATACAGTTGATTTCATCGAGCATGCATTGGCACT...

Protein

Download Protein FASTA

308 aa · LXL04_010300|LXL04_010300|OH1004|PROTEIN

MVSGIPKSAPPFTSDTNSSSIPAFFSVVTTKSAHPRSFNGADFLKSKPSLCGFPSLLLLLRSRIPPSRTKYGLDDNTVDFIEHALALYRADSYLDQPAIDFIKRVKVAVCRIISKVCRRFSIYLPPLWTRRITSGFARLSAVYGGTYMLNGFRGIRQPKCLIWYWNSDNRHFLSKRFSLEIGSRQVIGFVRSFILIVGVLLCLRILGGNIFSISDGNFGGIFVKMEGTVFTGSQGAAEIRDYIHVMGLADGHVAALKKLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010300`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010300

Location Chr02:143893750-143898295 (+)

Description Similar to At5g09550: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09550`	Regulates the GDP/GTP exchange reaction of most RAB proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP.	No verified direct reference in this release
`At3g59920`	Regulates the GDP/GTP exchange reaction of most RAB proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP.	AtGDI2, a novel Arabidopsis gene encoding a Rab GDP dissociation inhibitor.1998 · DOI: 10.1016/s0378-1119(97)00584-2

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010300 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032482 Rab protein signal transduction Biological Process

GO:0034123 positive regulation of toll-like receptor signaling pathway Biological Process

GO:0034142 toll-like receptor 4 signaling pathway Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0090315 negative regulation of protein targeting to membrane Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT3G59920

ath:AT5G09550

mmu:14567

rno:25183

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.267

Rank 1 · LXL04_010300 · OH-1004

Cytoplasm0.228

Rank 2 · LXL04_010300 · OH-1004

Plastid0.176

Rank 3 · LXL04_010300 · OH-1004

Endoplasmic reticulum0.152

Rank 4 · LXL04_010300 · OH-1004

Mitochondrion0.145

Rank 5 · LXL04_010300 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00996.25GDI69-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010300	`PF00996.25`	GDI	69	150	2.4e-20	73.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXC0`	Arabidopsis thaliana	Guanosine nucleotide diphosphate dissociation inhibitor At5g09550	49.515%	Swiss-Prot	weak database homology
`O24653`	Arabidopsis thaliana	Guanosine nucleotide diphosphate dissociation inhibitor 2	46.465%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card