LXL04_010260 | RubberDandelionOmics

Gene overview

LXL04_010260

Reference: OH-1004 Chr: Chr02 Coordinates: 143386611-143387087 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · LXL04_010260|LXL04_010260|OH1004|cDNA

ATGGCGTCTCCTCGAGAGGGACACTACAGGGGCGTAAGGAAGCGACCGTGGGGCCGTTACGCGGCGGAGATACGTGACCCTTGGAAGAAAACCCGTGTCTGGTTAGGCACTTTTGATACGCCGGTGGAAGCCGCCATGGCTTACGATGGTGCCGCACGCTCCCTTCGTGGCCCTAAAGCCAAGACAAACTTTCCAATGACGCCACCACCACTACCGCCACCATCGTTGTCTCTAAACCTCAACAGCTTCCCGTCCGAGCA...

CDS

Download CDS FASTA

477 bp · LXL04_010260|LXL04_010260|OH1004|CDS

ATGGCGTCTCCTCGAGAGGGACACTACAGGGGCGTAAGGAAGCGACCGTGGGGCCGTTACGCGGCGGAGATACGTGACCCTTGGAAGAAAACCCGTGTCTGGTTAGGCACTTTTGATACGCCGGTGGAAGCCGCCATGGCTTACGATGGTGCCGCACGCTCCCTTCGTGGCCCTAAAGCCAAGACAAACTTTCCAATGACGCCACCACCACTACCGCCACCATCGTTGTCTCTAAACCTCAACAGCTTCCCGTCCGAGCA...

Protein

Download Protein FASTA

158 aa · LXL04_010260|LXL04_010260|OH1004|PROTEIN

MASPREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPVEAAMAYDGAARSLRGPKAKTNFPMTPPPLPPPSLSLNLNSFPSEQHIGRLVAAQPDKHVVSGGEFRFLLSGGCCSSGGGAGEFPLAEESEVKMAGFLGLYRRGLGIDLNEPPPIWL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010260`
TK1151 ID	TkA03G515970
OH-1004 ID	LXL04_010260
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010260

Location Chr02:143386611-143387087 (-)

Description Similar to ERF12: Ethylene-responsive transcription factor 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28360`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release
`At3g20310`	Involved in the regulation of gene expression by abscisic acid, stress factors and by components of stress signal transduction pathways.	Role of an Arabidopsis AP2/EREBP-type transcriptional repressor in abscisic acid and drought stress responses.2005 · DOI: 10.1105/tpc.105.033043
`At5g44210`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010260 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G28360

ath:AT3G20310

ath:AT5G44210

nsy:104222902

nta:107778042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · LXL04_010260 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_010260 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_010260 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_010260 · OH-1004

Plastid0.017

Rank 5 · LXL04_010260 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP28-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010260	`PF00847.27`	AP2	8	57	5.5e-14	52.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94ID6`	Arabidopsis thaliana	Ethylene-responsive transcription factor 12	49.206%	Swiss-Prot	moderate database homology
`Q9LDE4`	Arabidopsis thaliana	Ethylene-responsive transcription factor 7	56.075%	Swiss-Prot	moderate database homology
`Q9FE67`	Arabidopsis thaliana	Ethylene-responsive transcription factor 9	72.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card