LXL04_009934 | RubberDandelionOmics

Gene overview

LXL04_009934

Reference: OH-1004 Chr: Chr02 Coordinates: 136137068-136140032 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_009934|LXL04_009934|OH1004|cDNA

ATGGGGTTGCTAAGAGAAGTCCTGAACTCATCGAAACCATACCTAGCGATGGTTTCTCTCCAGTTTGGTTATGCCGGAATGTATATCATAACCATGATCGGCATGAAGCGAGGACTCAGCCACTGGATTCTCGTGGTCTATCGCCATGCCACGGCGACTCTCGTCATTTCTCCTTTTGCCTTTGCTTTTGAGAGGAAAATAAGGCCAAAGATGACACGTTCGGTCTTCGTTAAAGTTCTGCTTCTTGGTTTGCTAGAGCC...

CDS

Download CDS FASTA

1134 bp · LXL04_009934|LXL04_009934|OH1004|CDS

ATGGGGTTGCTAAGAGAAGTCCTGAACTCATCGAAACCATACCTAGCGATGGTTTCTCTCCAGTTTGGTTATGCCGGAATGTATATCATAACCATGATCGGCATGAAGCGAGGACTCAGCCACTGGATTCTCGTGGTCTATCGCCATGCCACGGCGACTCTCGTCATTTCTCCTTTTGCCTTTGCTTTTGAGAGGAAAATAAGGCCAAAGATGACACGTTCGGTCTTCGTTAAAGTTCTGCTTCTTGGTTTGCTAGAGCC...

Protein

Download Protein FASTA

377 aa · LXL04_009934|LXL04_009934|OH1004|PROTEIN

MGLLREVLNSSKPYLAMVSLQFGYAGMYIITMIGMKRGLSHWILVVYRHATATLVISPFAFAFERKIRPKMTRSVFVKVLLLGLLEPVIDQNLYFLGMSITSATYASAIVNVLPALTFVMALVFRLEKVNLKRIHSQAKVIGTVITLVGATVMTLYKGPIVDILWYSHHGATTTPEAAAAASSGQHWLAGTIMILICTCCWAGYFILQSITLKEYPAELSLTSLICLAGTVEGGIIAIIMERDPKAWALGFDSRLLASVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009934`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009934

Location Chr02:136137068-136140032 (-)

Description Similar to At1g21890: WAT1-related protein At1g21890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21890`	WAT1-related protein At1g21890.	No verified direct reference in this release
`At1g44800`	WAT1-related protein At1g44800.	No verified direct reference in this release
`At4g08300`	WAT1-related protein At4g08300.	No verified direct reference in this release
`At2g39510`	WAT1-related protein At2g39510.	No verified direct reference in this release
`At4g08290`	WAT1-related protein At4g08290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009934 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009620 response to fungus Biological Process

GO:0032973 amino acid export across plasma membrane Biological Process

GO:0043090 amino acid import Biological Process

GO:0048316 seed development Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0098712 L-glutamate import across plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015186 L-glutamine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21890

ath:AT1G44800

ath:AT2G39510

ath:AT4G08290

ath:AT4G08300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.521

Rank 1 · LXL04_009934 · OH-1004

Lysosome / Vacuole0.179

Rank 2 · LXL04_009934 · OH-1004

Endoplasmic reticulum0.161

Rank 3 · LXL04_009934 · OH-1004

Cytoplasm0.071

Rank 4 · LXL04_009934 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_009934 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892.27EamA14-154 aa

PF00892.27EamA189-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009934	`PF00892.27`	EamA	14	154	2e-23	83.9
LXL04_009934	`PF00892.27`	EamA	189	327	2e-23	83.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HZQ7`	Arabidopsis thaliana	WAT1-related protein At1g21890	59.026%	Swiss-Prot	strong database homology
`Q9LPF1`	Arabidopsis thaliana	WAT1-related protein At1g44800	58.382%	Swiss-Prot	strong database homology
`Q501F8`	Arabidopsis thaliana	WAT1-related protein At4g08300	55.342%	Swiss-Prot	strong database homology
`O80638`	Arabidopsis thaliana	WAT1-related protein At2g39510	51.475%	Swiss-Prot	strong database homology
`Q9SUF1`	Arabidopsis thaliana	WAT1-related protein At4g08290	49.036%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card