LXL04_009751 | RubberDandelionOmics

Gene overview

LXL04_009751

Reference: OH-1004 Chr: Chr02 Coordinates: 132593167-132606766 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1989 bp · LXL04_009751|LXL04_009751|OH1004|cDNA

ATGGAAACAACAGTAGCAGCAATGTCGACGTCGCTCGGTCTTGAGAAAGGGACACCCACAAAACTTGAGGGGAAGTTTACTGCAATGGTGGTGTGTTGGCTTCTTGGAATCGGGTGTGCGTTTGCTTGGAATAGCATGCTGACCATAGAAGATTACTATGTTATCTTGTTTCCGAAAGATCACCCCACGAGAGTCCTGACACTCGTATACCAACCATTTGCCCTTGTAGCACTCGCAATACTTACATACCATGAGGCGAA...

CDS

Download CDS FASTA

1989 bp · LXL04_009751|LXL04_009751|OH1004|CDS

ATGGAAACAACAGTAGCAGCAATGTCGACGTCGCTCGGTCTTGAGAAAGGGACACCCACAAAACTTGAGGGGAAGTTTACTGCAATGGTGGTGTGTTGGCTTCTTGGAATCGGGTGTGCGTTTGCTTGGAATAGCATGCTGACCATAGAAGATTACTATGTTATCTTGTTTCCGAAAGATCACCCCACGAGAGTCCTGACACTCGTATACCAACCATTTGCCCTTGTAGCACTCGCAATACTTACATACCATGAGGCGAA...

Protein

Download Protein FASTA

662 aa · LXL04_009751|LXL04_009751|OH1004|PROTEIN

METTVAAMSTSLGLEKGTPTKLEGKFTAMVVCWLLGIGCAFAWNSMLTIEDYYVILFPKDHPTRVLTLVYQPFALVALAILTYHEANMNTRKRNLFGYMLFFLGTLAVLLLDLATSGKGGIGSFVGICATSAAFGVADAYVQGGMVGDLSFMLPEFIQSFLAGLSASGALTSGLRLFTKGVFDNSQNGLRKGALLFFTLCTIFELLCVLLYAFVFPKLPVVKYYRSKAASEGSKTVSADLAAGGIYSYSNKEEANSTKLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009751`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009751

Location Chr02:132593167-132606766 (+)

Description Similar to ENT3: Equilibrative nucleotide transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05120`	Nucleoside transporter that functions as a pyrimidine nucleoside carrier in all organs.	Equilibrative nucleoside transporters of Arabidopsis thaliana. cDNA cloning, expression pattern, and analysis of transport activities.2003 · DOI: 10.1074/jbc.m304768200 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 The fluorouridine insensitive 1 (fur1) mutant is defective in equilibrative nucleoside transporter 3 (ENT3), and thus represents an important pyrimidine nucleoside uptake system in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2006.02998.x Nucleoside transport across the plasma membrane mediated by equilibrative nucleoside transporter 3 influences metabolism of Arabidopsis seedlings.2012 · DOI: 10.1111/j.1438-8677.2012.00562.x
`At4g05110`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At4g05140`	May be involved in nucleoside transport.	No verified direct reference in this release
`At3g09990`	May be involved in nucleoside transport.	No verified direct reference in this release
`At4g05130`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009751 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015858 nucleoside transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005337 nucleoside transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G05110

ath:AT4G05120

ath:AT4G05140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.646

Rank 1 · LXL04_009751 · OH-1004

Lysosome / Vacuole0.160

Rank 2 · LXL04_009751 · OH-1004

Endoplasmic reticulum0.121

Rank 3 · LXL04_009751 · OH-1004

Cytoplasm0.077

Rank 4 · LXL04_009751 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_009751 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01733.25Nucleoside_tran134-236 aa

PF01733.25Nucleoside_tran280-393 aa

PF01733.25Nucleoside_tran490-657 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009751	`PF01733.25`	Nucleoside_tran	134	236	5e-37	128.7
LXL04_009751	`PF01733.25`	Nucleoside_tran	280	393	5e-37	128.7
LXL04_009751	`PF01733.25`	Nucleoside_tran	490	657	5e-37	128.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Y3`	Arabidopsis thaliana	Equilibrative nucleotide transporter 3	63.171%	Swiss-Prot	moderate database homology
`Q944N8`	Arabidopsis thaliana	Equilibrative nucleotide transporter 6	59.756%	Swiss-Prot	moderate database homology
`Q9M0Y1`	Arabidopsis thaliana	Equilibrative nucleotide transporter 5	57.805%	Swiss-Prot	moderate database homology
`Q9SR64`	Arabidopsis thaliana	Equilibrative nucleotide transporter 2	57.882%	Swiss-Prot	moderate database homology
`Q9M0Y2`	Arabidopsis thaliana	Equilibrative nucleotide transporter 4	57.039%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card