LXL04_008761 | RubberDandelionOmics

Gene overview

LXL04_008761

Reference: OH-1004 Chr: Chr02 Coordinates: 108245071-108246408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_008761|LXL04_008761|OH1004|cDNA

ATGGCTTCTTTGCAACTGCAACCATCCATGCATTTCAATTTATTTGTATTTCTTTGTGTTTTTGGAACTTTTGTTTCCGGCCAGTTCACCAACTTTAACAAATTAGTATTACCACAAGGTGTCACTGGTCCTGAATCAGCAGCATTTGGACCTCTAGGCACGGGGCCATTCACAACTGTTGCCGATGGTAGGATCCTAAAATGGCAAGGCCCAACTATCGGTTTTGTGGATTTTGCATATACTTCACCAAGAAGGACTAA...

CDS

Download CDS FASTA

993 bp · LXL04_008761|LXL04_008761|OH1004|CDS

ATGGCTTCTTTGCAACTGCAACCATCCATGCATTTCAATTTATTTGTATTTCTTTGTGTTTTTGGAACTTTTGTTTCCGGCCAGTTCACCAACTTTAACAAATTAGTATTACCACAAGGTGTCACTGGTCCTGAATCAGCAGCATTTGGACCTCTAGGCACGGGGCCATTCACAACTGTTGCCGATGGTAGGATCCTAAAATGGCAAGGCCCAACTATCGGTTTTGTGGATTTTGCATATACTTCACCAAGAAGGACTAA...

Protein

Download Protein FASTA

330 aa · LXL04_008761|LXL04_008761|OH1004|PROTEIN

MASLQLQPSMHFNLFVFLCVFGTFVSGQFTNFNKLVLPQGVTGPESAAFGPLGTGPFTTVADGRILKWQGPTIGFVDFAYTSPRRTKQVCDGTRDPNMGPICGRPLALSFNPVTGLLYIADGFFGLLFVGPTGGLATQLAGGFKFLVGVEVDLLTRNVYFSDASLTYDIRDTTKPGFVPDSTGRLLRYNPHTRQVSVLLSGLSGGGGPAISKNRTFVLVPELTGKRILKYWLVGPKANTAELFLNIGGNPNKIKRAGRFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008761`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008761

Location Chr02:108245071-108246408 (-)

Description Similar to SSL12: Protein STRICTOSIDINE SYNTHASE-LIKE 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57030`	Protein STRICTOSIDINE SYNTHASE-LIKE 10.	No verified direct reference in this release
`At1g74020`	Catalyzes the stereospecific condensation of tryptamine with secologanin to form strictosidine, the key intermediate of indole alkaloid biosynthesis.	No verified direct reference in this release
`At1g74000`	Catalyzes the stereospecific condensation of tryptamine with secologanin to form strictosidine, the key intermediate of indole alkaloid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008761 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0009821 alkaloid biosynthetic process Biological Process

GO:0035834 indole alkaloid metabolic process Biological Process

GO:0051365 cellular response to potassium ion starvation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ag:CAA44208

ath:AT1G74000

ath:AT1G74020

ath:AT3G57030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.651

Rank 1 · LXL04_008761 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_008761 · OH-1004

Endoplasmic reticulum0.074

Rank 3 · LXL04_008761 · OH-1004

Lysosome / Vacuole0.065

Rank 4 · LXL04_008761 · OH-1004

Cell membrane0.053

Rank 5 · LXL04_008761 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03088.23Str_synth150-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008761	`PF03088.23`	Str_synth	150	234	1.3e-18	67.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D9`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 10	38.788%	Swiss-Prot	moderate database homology
`P94111`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 12	40.461%	Swiss-Prot	moderate database homology
`P92976`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 11	40.984%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card