LXL04_008650 | RubberDandelionOmics

Gene overview

LXL04_008650

Reference: OH-1004 Chr: Chr02 Coordinates: 105173382-105176848 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · LXL04_008650|LXL04_008650|OH1004|cDNA

ATGATTCAGAAGTCGGAGGAAAAGAAGAAAACAACCATTGCTTCCCAAGCTTCTGTGACCAATAGAGAAACAAGGCAGATGAAATGGTCCCTTGAGAGGAATCAGATGGCAGCTACATCATCAAGTTCCTTCTCTATCGGATCAATACCCCATGGTTCCAAAACCTGCTCACTTGGACAATCAAACAACCATGGAATAAAATTCAATTCACGAAACCATCTTAACAATTTCACCGGCCTCAAGGCAGTCACATCTATAAA...

CDS

Download CDS FASTA

1308 bp · LXL04_008650|LXL04_008650|OH1004|CDS

ATGATTCAGAAGTCGGAGGAAAAGAAGAAAACAACCATTGCTTCCCAAGCTTCTGTGACCAATAGAGAAACAAGGCAGATGAAATGGTCCCTTGAGAGGAATCAGATGGCAGCTACATCATCAAGTTCCTTCTCTATCGGATCAATACCCCATGGTTCCAAAACCTGCTCACTTGGACAATCAAACAACCATGGAATAAAATTCAATTCACGAAACCATCTTAACAATTTCACCGGCCTCAAGGCAGTCACATCTATAAA...

Protein

Download Protein FASTA

435 aa · LXL04_008650|LXL04_008650|OH1004|PROTEIN

MIQKSEEKKKTTIASQASVTNRETRQMKWSLERNQMAATSSSSFSIGSIPHGSKTCSLGQSNNHGIKFNSRNHLNNFTGLKAVTSINPNSNSKSSIFGNNITVRPATITKTRPNTIKVTASFKVAILGAAGGIGQPLSLLVKMSPLVSDLHLYDIANVKGVAADLSHCNTPSKVRDFTGATELPNCLQDIDIVVIPAGVPRKPGMTRDDLFNINASIVKTLVEAVADNCPNAFIHVISNPVNSTVPIAAEILKQKGVYNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008650`
TK1151 ID	TkA03G349430
OH-1004 ID	LXL04_008650
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 91.954 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008650

Location Chr02:105173382-105176848 (+)

Description Similar to At3g47520: Malate dehydrogenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47520`	Catalyzes a reversible NAD-dependent dehydrogenase reaction involved in central metabolism and redox homeostasis between organelle compartments (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0632700`	Malate dehydrogenase, glyoxysomal.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008650 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006097 glyoxylate cycle Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006108 malate metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

KEGG gene cross-reference

ath:AT3G47520

csv:101219252

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_008650 · OH-1004

Mitochondrion0.041

Rank 2 · LXL04_008650 · OH-1004

Cytoplasm0.017

Rank 3 · LXL04_008650 · OH-1004

Nucleus0.012

Rank 4 · LXL04_008650 · OH-1004

Peroxisome0.011

Rank 5 · LXL04_008650 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00056.30Ldh_1_N123-265 aa

PF02866.24Ldh_1_C267-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008650	`PF00056.30`	Ldh_1_N	123	265	2e-48	164.7
LXL04_008650	`PF02866.24`	Ldh_1_C	267	432	7.4e-43	147.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN86`	Arabidopsis thaliana	Malate dehydrogenase, chloroplastic	72.705%	Swiss-Prot	strong database homology
`Q42972`	Oryza sativa subsp. japonica	Malate dehydrogenase, glyoxysomal	66.879%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card