LXL04_008614 | RubberDandelionOmics

Gene overview

LXL04_008614

Reference: OH-1004 Chr: Chr02 Coordinates: 104247670-104254012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2367 bp · LXL04_008614|LXL04_008614|OH1004|cDNA

ATGGGCACTGCTATTAAGACTGAAGGGTGTGGGACTCAAATGCCATCGACAAATCCTTACCGCCCAACCATTGCTGCCGGTAAAGTTTTTGATACGGGCCGTCTCAAGCATCTCCCGATTCCGATTTCAATCGATCTTCGACTTTGCGATCCGAGCGATCTCTGCAACTCCATAAAAACCATATTTCGTCAAGTGGCTTATCGCCTCCTCACCCGATCTACCAACACTTACACAGCCGGCGCCGCTGCTACCCTTCGCCG...

CDS

Download CDS FASTA

2367 bp · LXL04_008614|LXL04_008614|OH1004|CDS

ATGGGCACTGCTATTAAGACTGAAGGGTGTGGGACTCAAATGCCATCGACAAATCCTTACCGCCCAACCATTGCTGCCGGTAAAGTTTTTGATACGGGCCGTCTCAAGCATCTCCCGATTCCGATTTCAATCGATCTTCGACTTTGCGATCCGAGCGATCTCTGCAACTCCATAAAAACCATATTTCGTCAAGTGGCTTATCGCCTCCTCACCCGATCTACCAACACTTACACAGCCGGCGCCGCTGCTACCCTTCGCCG...

Protein

Download Protein FASTA

788 aa · LXL04_008614|LXL04_008614|OH1004|PROTEIN

MGTAIKTEGCGTQMPSTNPYRPTIAAGKVFDTGRLKHLPIPISIDLRLCDPSDLCNSIKTIFRQVAYRLLTRSTNTYTAGAAATLRRPCATEVSADTAPGDSAFSEAWKKVAPTIDPPKILIQFMEPRPPTPSSLPAKLTVNFVLPYSSELSKKEVDMVIVPATTGQMGILPGHVPMSFVSLFRFRLISNLLITDLFRAAAVSRAFIPGVGKLNLVMATPSKSVAYSEISVALDLRQQDLRQHLVKCWIRPKATLLRPNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008614`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008614

Location Chr02:104247670-104254012 (-)

Description Similar to ATP synthase subunit delta', mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47030`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008614 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009403 toxin biosynthetic process Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0004312 fatty acid synthase activity Molecular Function

GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G47030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.515

Rank 1 · LXL04_008614 · OH-1004

Cytoplasm0.245

Rank 2 · LXL04_008614 · OH-1004

Mitochondrion0.164

Rank 3 · LXL04_008614 · OH-1004

Plastid0.062

Rank 4 · LXL04_008614 · OH-1004

Peroxisome0.030

Rank 5 · LXL04_008614 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02823.23ATP-synt_DE_N138-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008614	`PF02823.23`	ATP-synt_DE_N	138	177	8.1e-08	32.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96252`	Arabidopsis thaliana	ATP synthase subunit delta', mitochondrial	59.483%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card