LXL04_007894 | RubberDandelionOmics

Gene overview

LXL04_007894

Reference: OH-1004 Chr: Chr02 Coordinates: 71173028-71179073 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · LXL04_007894|LXL04_007894|OH1004|cDNA

ATGGCAATAGGGAGGAAGAGAACAGATAGAGACAAGAGGGTATTTCGGTCAAAAGTGGAAGAATCTATTTCTGAGGGACAATCTTGCGTTTTTGGATTATTTTTGGCTTCATTCACTGTTCAATTACAGGAAAAGCAAAAACTGAAAGTGAAAGAAAAGCTTGACAAGTATCACAAAGAGAAGCTGTTAGAATTCTGCAATCTGTTTGACATGCCAATTGCCAAAACTTCCGCAAAGAAGGAAGATGTTGTTGTAAAGCT...

CDS

Download CDS FASTA

1932 bp · LXL04_007894|LXL04_007894|OH1004|CDS

ATGGCAATAGGGAGGAAGAGAACAGATAGAGACAAGAGGGTATTTCGGTCAAAAGTGGAAGAATCTATTTCTGAGGGACAATCTTGCGTTTTTGGATTATTTTTGGCTTCATTCACTGTTCAATTACAGGAAAAGCAAAAACTGAAAGTGAAAGAAAAGCTTGACAAGTATCACAAAGAGAAGCTGTTAGAATTCTGCAATCTGTTTGACATGCCAATTGCCAAAACTTCCGCAAAGAAGGAAGATGTTGTTGTAAAGCT...

Protein

Download Protein FASTA

643 aa · LXL04_007894|LXL04_007894|OH1004|PROTEIN

MAIGRKRTDRDKRVFRSKVEESISEGQSCVFGLFLASFTVQLQEKQKLKVKEKLDKYHKEKLLEFCNLFDMPIAKTSAKKEDVVVKLIDFMLTPHATTSELISKKEQSSKGKKRTSSSKKRTPPSRSSSKTTFTDILKQLAKRFSTDLTSRKASIKLMIQEELTKLADEADEEDKEEAVEAKGKLLAHSEGSSEAAYLAAGSVLDVAAKVAKGELNSAFAIVRPPGHHAEQNEPMGFCLFNNELGINKILIVDWDVHHGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007894`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007894

Location Chr02:71173028-71179073 (-)

Description Similar to XLG3: Extra-large guanine nucleotide-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31930`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Regulation of root-wave response by extra large and conventional G proteins in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03506.x
`At2g23460`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x
`At5g61070`	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).	Histone acetylation affects expression of cellular patterning genes in the Arabidopsis root epidermis.2005 · DOI: 10.1073/pnas.0503143102 HDA18 affects cell fate in Arabidopsis root epidermis via histone acetylation at four kinase genes.2013 · DOI: 10.1105/tpc.112.107045
`At5g61060`	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (Probable).	Regulation of flowering time by the histone deacetylase HDA5 in Arabidopsis.2015 · DOI: 10.1111/tpj.12868
`At4g34390`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Arabidopsis extra large G-protein 2 (XLG2) interacts with the Gbeta subunit of heterotrimeric G protein and functions in disease resistance.2009 · DOI: 10.1093/mp/ssp001 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.317412

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007894 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009908 flower development Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

KEGG gene cross-reference

ath:AT1G31930

ath:AT2G23460

ath:AT4G34390

ath:AT5G61060

ath:AT5G61070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.439

Rank 1 · LXL04_007894 · OH-1004

Cytoplasm0.375

Rank 2 · LXL04_007894 · OH-1004

Mitochondrion0.149

Rank 3 · LXL04_007894 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_007894 · OH-1004

Cell membrane0.076

Rank 5 · LXL04_007894 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08766.17DEK_C130-163 aa

PF00850.25Hist_deacetyl164-268 aa

PF00503.27G-alpha485-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007894	`PF08766.17`	DEK_C	130	163	4.6e-06	27.2
LXL04_007894	`PF00850.25`	Hist_deacetyl	164	268	5.5e-25	89.0
LXL04_007894	`PF00503.27`	G-alpha	485	603	2.3e-16	60.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C516`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 3	72.956%	Swiss-Prot	weak database homology
`O80462`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 1	53.378%	Swiss-Prot	weak database homology
`Q8LRK8`	Arabidopsis thaliana	Histone deacetylase 18	52.174%	Swiss-Prot	weak database homology
`Q8RX28`	Arabidopsis thaliana	Histone deacetylase 5	60.825%	Swiss-Prot	weak database homology
`C6KIE6`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 2	39.623%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card