LXL04_007449 | RubberDandelionOmics

Gene overview

LXL04_007449

Reference: OH-1004 Chr: Chr02 Coordinates: 48903944-48904811 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · LXL04_007449|LXL04_007449|OH1004|cDNA

ATGATATTGACCGACCCGACCCAGGATTGGCTGTTATATCACAATATCCTTATCTCCAACGATACACCGTCCAAAGAGACTGGTACGAGTAACCTCAGCAACAACAAGATGCTCACCCTCTCCATTGCTTCTTCTACTTCCGCTATTACATCCACTCCCAAGTCCACCTTCACTTCTTCAACCCTCACCCACAAATCTTCCTTCAATGGCATACGAATTGCTCATGTTCTCCCCTCACCTGCCGTTCGAGCAACAGCCGC...

CDS

Download CDS FASTA

630 bp · LXL04_007449|LXL04_007449|OH1004|CDS

ATGATATTGACCGACCCGACCCAGGATTGGCTGTTATATCACAATATCCTTATCTCCAACGATACACCGTCCAAAGAGACTGGTACGAGTAACCTCAGCAACAACAAGATGCTCACCCTCTCCATTGCTTCTTCTACTTCCGCTATTACATCCACTCCCAAGTCCACCTTCACTTCTTCAACCCTCACCCACAAATCTTCCTTCAATGGCATACGAATTGCTCATGTTCTCCCCTCACCTGCCGTTCGAGCAACAGCCGC...

Protein

Download Protein FASTA

209 aa · LXL04_007449|LXL04_007449|OH1004|PROTEIN

MILTDPTQDWLLYHNILISNDTPSKETGTSNLSNNKMLTLSIASSTSAITSTPKSTFTSSTLTHKSSFNGIRIAHVLPSPAVRATAAPRQSVVMMAKREEELKEIRAKTTEEINDEIVDLKGELFMLRLQRSARNEFKSSEFRRMRKRVARMMTVKREREIDDGVGKRQSRKLDRQWRKSIVPRPPPSLLKLQQEEAAEEAKEAASASA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007449`
TK1151 ID	TkA03G178160
OH-1004 ID	LXL04_007449
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007449

Location Chr02:48903944-48904811 (+)

Description Similar to RPL29: 50S ribosomal protein L29, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65220`	Large ribosomal subunit protein uL29c.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007449 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT5G65220

cyt:cce_4022

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · LXL04_007449 · OH-1004

Mitochondrion0.033

Rank 2 · LXL04_007449 · OH-1004

Nucleus0.018

Rank 3 · LXL04_007449 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_007449 · OH-1004

Cell membrane0.006

Rank 5 · LXL04_007449 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00831.29Ribosomal_L29103-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007449	`PF00831.29`	Ribosomal_L29	103	159	3.5e-14	53.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJP3`	Arabidopsis thaliana	Large ribosomal subunit protein uL29c	64.198%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card