Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4044 bp · LXL04_007038|LXL04_007038|OH1004|cDNA
ATGACATCGCCATCGTCGTCCAAACccaaaaccctaaccctagatTCTACAGCCTTATTTCTTCAATCCCCACAAACCACTCTGCCTCCTccactctctttctctcttctttcaTCGCGCTCGCCTCTTCCTCCACTACCCGCAGATTTTCCCATCCCCAAACTTATCCCTAAAACTAAATTTATCGTCGACGGGTTCCGATTATCCGGCGACTACTCCGTATCCTATTTCCTCTCACATTTCCACTCAGACCACTACGG...
4044 bp · LXL04_007038|LXL04_007038|OH1004|CDS
ATGACATCGCCATCGTCGTCCAAACCCAAAACCCTAACCCTAGATTCTACAGCCTTATTTCTTCAATCCCCACAAACCACTCTGCCTCCTCCACTCTCTTTCTCTCTTCTTTCATCGCGCTCGCCTCTTCCTCCACTACCCGCAGATTTTCCCATCCCCAAACTTATCCCTAAAACTAAATTTATCGTCGACGGGTTCCGATTATCCGGCGACTACTCCGTATCCTATTTCCTCTCACATTTCCACTCAGACCACTACGG...
Protein
Download Protein FASTA1347 aa · LXL04_007038|LXL04_007038|OH1004|PROTEIN
MTSPSSSKPKTLTLDSTALFLQSPQTTLPPPLSFSLLSSRSPLPPLPADFPIPKLIPKTKFIVDGFRLSGDYSVSYFLSHFHSDHYGGINANWSKGIIFCSEITARLVIQVLQVSALFVVPLPLSEPVLIDGCEISLVDANHCPGAVQFLFKIPTADGSYERYVHTGDFRYCSSMKSETVLNEFTGADAVFLDTTYCNPKYVFPSQQESIDYVVSVIDKYSIENNGGLKSVLFLVATYVIGKEKILLEIARRCKRKIHVD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007038 |
|---|---|
| TK1151 ID | TkA03G105280 |
| OH-1004 ID | LXL04_007038 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007038 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:34208821-34214813 (+) | |||||||||
| Description | Similar to LIG6: DNA ligase 6 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000012 single strand break repair Biological Process GO:0002237 response to molecule of bacterial origin Biological Process GO:0006260 DNA replication Biological Process GO:0006273 lagging strand elongation Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006303 double-strand break repair via nonhomologous end joining Biological Process GO:0006310 DNA recombination Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009409 response to cold Biological Process GO:0009845 seed germination Biological Process GO:0010225 response to UV-C Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G08130 ath:AT1G66730 ddi:DDB_G0274493 dme:Dmel_CG5602 xla:397978 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07522.20DRMBL275-380 aaPF04675.20DNA_ligase_A_N724-900 aaPF01068.27DNA_ligase_A_M962-1182 aaPF04679.22DNA_ligase_A_C1208-1319 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007038 | PF07522.20 | DRMBL | 275 | 380 | 7e-21 | 75.2 |
| LXL04_007038 | PF04675.20 | DNA_ligase_A_N | 724 | 900 | 6.9e-43 | 147.5 |
| LXL04_007038 | PF01068.27 | DNA_ligase_A_M | 962 | 1182 | 3.8e-50 | 171.1 |
| LXL04_007038 | PF04679.22 | DNA_ligase_A_C | 1208 | 1319 | 9.8e-20 | 71.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.