LXL04_006524 | RubberDandelionOmics

Gene overview

LXL04_006524

Reference: OH-1004 Chr: Chr02 Coordinates: 12772044-12776854 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3465 bp · LXL04_006524|LXL04_006524|OH1004|cDNA

ATGGGTCGTCTTCACAAACCATATAACTTCTTGTTAATTACCTTATTCGTATTCACATCATCTTCTTACTTCCACGCTGTTTCCGGCGATGATTCCGACAAATCGACTCTTCTGGAGTTCAAGGCCGCCGTTTCGGATCCTTCAGGAGTGCTTATGAGCTGGAATTTAAACAGTTCGGATCATTGTTCGTGGATCGGAGTCACATGTGCGTCAGAATCTAGGGTTGTGGCGATTAACATCACAGGTGGAGGTAACGCCGG...

CDS

Download CDS FASTA

3465 bp · LXL04_006524|LXL04_006524|OH1004|CDS

ATGGGTCGTCTTCACAAACCATATAACTTCTTGTTAATTACCTTATTCGTATTCACATCATCTTCTTACTTCCACGCTGTTTCCGGCGATGATTCCGACAAATCGACTCTTCTGGAGTTCAAGGCCGCCGTTTCGGATCCTTCAGGAGTGCTTATGAGCTGGAATTTAAACAGTTCGGATCATTGTTCGTGGATCGGAGTCACATGTGCGTCAGAATCTAGGGTTGTGGCGATTAACATCACAGGTGGAGGTAACGCCGG...

Protein

Download Protein FASTA

1154 aa · LXL04_006524|LXL04_006524|OH1004|PROTEIN

MGRLHKPYNFLLITLFVFTSSSYFHAVSGDDSDKSTLLEFKAAVSDPSGVLMSWNLNSSDHCSWIGVTCASESRVVAINITGGGNAGDFTCSKYNQFPLYGFGIAKNCLDLNAKLVGKLSSAISKLSELRILSLPFNDLSGEIPPEIWGMEKLEVIDLEGNLIHGSLQSHFSGLKNLRVLNLGFNQISGEIPNSISQFKNLQVLNLAGNHINGSIPRILDNFGDLRGLYLSFNQLSGNIPIEIGYNCGNLENLELAGNLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006524`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006524

Location Chr02:12772044-12776854 (-)

Description Similar to RPK2: LRR receptor-like serine/threonine-protein kinase RPK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02130`	Key regulator of anther development (e.g. lignification pattern), including tapetum degradation during pollen maturation (e.g. germination capacity).	Receptor-like protein kinase 2 (RPK 2) is a novel factor controlling anther development in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03083.x RPK1 and TOAD2 are two receptor-like kinases redundantly required for arabidopsis embryonic pattern formation.2007 · DOI: 10.1016/j.devcel.2007.04.003 Two receptor-like kinases required together for the establishment of Arabidopsis cotyledon primordia.2008 · DOI: 10.1016/j.ydbio.2007.11.021
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At1g69270`	Involved in the main abscisic acid-mediated (ABA) signaling pathway and in early ABA perception.	Leucine-rich repeat receptor-like kinase1 is a key membrane-bound regulator of abscisic acid early signaling in Arabidopsis.2005 · DOI: 10.1105/tpc.104.027474 RPK1 and TOAD2 are two receptor-like kinases redundantly required for arabidopsis embryonic pattern formation.2007 · DOI: 10.1016/j.devcel.2007.04.003 Two receptor-like kinases required together for the establishment of Arabidopsis cotyledon primordia.2008 · DOI: 10.1016/j.ydbio.2007.11.021
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At5g07280`	Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006524 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009942 longitudinal axis specification Biological Process

GO:0009945 radial axis specification Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010152 pollen maturation Biological Process

GO:0048508 embryonic meristem development Biological Process

KEGG gene cross-reference

ath:AT1G17230

ath:AT1G69270

ath:AT3G02130

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.863

Rank 1 · LXL04_006524 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_006524 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_006524 · OH-1004

Nucleus0.046

Rank 4 · LXL04_006524 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_006524 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_231-69 aa

PF23598.2LRR_14121-243 aa

PF13855.13LRR_8152-211 aa

PF29594.1LRR_SKP2152-321 aa

PF12799.14LRR_4175-211 aa

PF23598.2LRR_14193-323 aa

PF13855.13LRR_8195-235 aa

PF13855.13LRR_8249-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006524	`PF08263.18`	LRRNT_2	31	69	2.2e-14	54.1
LXL04_006524	`PF23598.2`	LRR_14	121	243	1.3e-23	84.1
LXL04_006524	`PF13855.13`	LRR_8	152	211	1.1e-35	121.9
LXL04_006524	`PF29594.1`	LRR_SKP2	152	321	2.1e-07	31.2
LXL04_006524	`PF12799.14`	LRR_4	175	211	8.5e-30	102.8
LXL04_006524	`PF23598.2`	LRR_14	193	323	1.3e-23	84.1
LXL04_006524	`PF13855.13`	LRR_8	195	235	1.1e-35	121.9
LXL04_006524	`PF13855.13`	LRR_8	249	308	1.1e-35	121.9
LXL04_006524	`PF13855.13`	LRR_8	576	634	1.1e-35	121.9
LXL04_006524	`PF23598.2`	LRR_14	620	700	1.3e-23	84.1
LXL04_006524	`PF12799.14`	LRR_4	646	684	8.5e-30	102.8
LXL04_006524	`PF13855.13`	LRR_8	647	706	1.1e-35	121.9
LXL04_006524	`PF00069.32`	Pkinase	836	1033	1.2e-41	143.6
LXL04_006524	`PF07714.24`	PK_Tyr_Ser-Thr	837	1032	1.9e-36	126.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7I6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RPK2	61.622%	Swiss-Prot	strong database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	34.844%	Swiss-Prot	moderate database homology
`Q9ZRF9`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase RPK1	56.250%	Swiss-Prot	weak database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	34.286%	Swiss-Prot	moderate database homology
`Q9LYN8`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase EMS1	32.405%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card