LXL04_005998 | RubberDandelionOmics

Gene overview

LXL04_005998

Reference: OH-1004 Chr: Chr01 Coordinates: 176763479-176767206 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2688 bp · LXL04_005998|LXL04_005998|OH1004|cDNA

ATGAGGGATATGGAGGAGAAGGGTTCAGAAGATTGGAGGGAGACCGTAAAGAAGATGCTACCTCCTGGAGCTATACTACCTGACGAAAGTGACGAGCTTGATTACTCAATCGCTTTAGAATACAGGGGTCCTAACGTTTCTTATCAGGTTCCAAGAATCGAACCACTAGAAGTAAATTCCCGTTGTATCCCAACAGCATCAGTAGCCGAATCATTTTCAGATTCAAGAAGATCCATCAACCGCGACACCCCCCAAGTAAT...

CDS

Download CDS FASTA

2688 bp · LXL04_005998|LXL04_005998|OH1004|CDS

ATGAGGGATATGGAGGAGAAGGGTTCAGAAGATTGGAGGGAGACCGTAAAGAAGATGCTACCTCCTGGAGCTATACTACCTGACGAAAGTGACGAGCTTGATTACTCAATCGCTTTAGAATACAGGGGTCCTAACGTTTCTTATCAGGTTCCAAGAATCGAACCACTAGAAGTAAATTCCCGTTGTATCCCAACAGCATCAGTAGCCGAATCATTTTCAGATTCAAGAAGATCCATCAACCGCGACACCCCCCAAGTAAT...

Protein

Download Protein FASTA

895 aa · LXL04_005998|LXL04_005998|OH1004|PROTEIN

MRDMEEKGSEDWRETVKKMLPPGAILPDESDELDYSIALEYRGPNVSYQVPRIEPLEVNSRCIPTASVAESFSDSRRSINRDTPQVIDPIPLPVSYIAHMTDSPNQSPSRLSRSSESVVSVLHNGDSFSASPSGSPGSVHNQQNGTNGVRRGRAPVVTFNTVDRSERKEVGPGYNSEYVAVSKEKKKKKTTKRRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRKCVTCIGEAIDESKRLDLGKNSRLLSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005998`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005998

Location Chr01:176763479-176767206 (-)

Description Similar to XLG3: Extra-large guanine nucleotide-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31930`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Regulation of root-wave response by extra large and conventional G proteins in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03506.x
`At2g23460`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x
`At4g34390`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Arabidopsis extra large G-protein 2 (XLG2) interacts with the Gbeta subunit of heterotrimeric G protein and functions in disease resistance.2009 · DOI: 10.1093/mp/ssp001 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.317412

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005998 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005834 heterotrimeric G-protein complex Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31930

ath:AT2G23460

ath:AT4G34390

gmx:547804

gmx:547977

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.445

Rank 1 · LXL04_005998 · OH-1004

Cytoplasm0.387

Rank 2 · LXL04_005998 · OH-1004

Nucleus0.296

Rank 3 · LXL04_005998 · OH-1004

Golgi apparatus0.063

Rank 4 · LXL04_005998 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_005998 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00503.27G-alpha448-860 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005998	`PF00503.27`	G-alpha	448	860	1.2e-78	265.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C516`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 3	64.906%	Swiss-Prot	strong database homology
`O80462`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 1	51.664%	Swiss-Prot	strong database homology
`C6KIE6`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 2	43.478%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card