LXL04_005965 | RubberDandelionOmics

Gene overview

LXL04_005965

Reference: OH-1004 Chr: Chr01 Coordinates: 176435213-176436035 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · LXL04_005965|LXL04_005965|OH1004|cDNA

ATGGAATATCTTCCTGGTGGTGACATGATGACTTTGTTAATGAGAGAAGACACATTAAAAGAAAATGTTGCAAAGTTTTACATAGCTCAAAGTGTCATGGCCATAGAGTCCATTCACAAACATAACTACATTCATAGATATATAAAACCAGACAACCTTCTTCTAGACAAAAACGGTCACATGAAGCTTTCAGATTTGGGGCTGTGTAAGCCTCTTGATTGTAGGACATTGTCCACATTGAATGAAAATGAAGCCATGAA...

CDS

Download CDS FASTA

606 bp · LXL04_005965|LXL04_005965|OH1004|CDS

ATGGAATATCTTCCTGGTGGTGACATGATGACTTTGTTAATGAGAGAAGACACATTAAAAGAAAATGTTGCAAAGTTTTACATAGCTCAAAGTGTCATGGCCATAGAGTCCATTCACAAACATAACTACATTCATAGATATATAAAACCAGACAACCTTCTTCTAGACAAAAACGGTCACATGAAGCTTTCAGATTTGGGGCTGTGTAAGCCTCTTGATTGTAGGACATTGTCCACATTGAATGAAAATGAAGCCATGAA...

Protein

Download Protein FASTA

201 aa · LXL04_005965|LXL04_005965|OH1004|PROTEIN

MEYLPGGDMMTLLMREDTLKENVAKFYIAQSVMAIESIHKHNYIHRYIKPDNLLLDKNGHMKLSDLGLCKPLDCRTLSTLNENEAMNDENIREPMEIDGFPDAVNGHGWKSAHEQLQHWQMNRRKLKAFSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYSDDPITTCRKIYIVSSYFNIMFINYCLIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005965`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005965`
Location	Chr01:176435213-176436035 (-)
Description	Similar to trc: Serine/threonine-protein kinase tricorner
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005965` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0007165 signal transduction Biological Process GO:0018105 peptidyl-serine phosphorylation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0036211 protein modification process Biological Process GO:0043407 negative regulation of MAP kinase activity Biological Process GO:0051012 microtubule sliding Biological Process GO:0099173 postsynapse organization Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	dme:Dmel_CG8637 dpo:4813412 hsa:11329 mmu:106504 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.585

Rank 1 · LXL04_005965 · OH-1004

Nucleus0.453

Rank 2 · LXL04_005965 · OH-1004

Mitochondrion0.075

Rank 3 · LXL04_005965 · OH-1004

Cell membrane0.068

Rank 4 · LXL04_005965 · OH-1004

Endoplasmic reticulum0.049

Rank 5 · LXL04_005965 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase1-73 aa

PF07714.24PK_Tyr_Ser-Thr1-75 aa

PF00069.32Pkinase128-179 aa

PF07714.24PK_Tyr_Ser-Thr134-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005965	`PF00069.32`	Pkinase	1	73	2e-34	119.9
LXL04_005965	`PF07714.24`	PK_Tyr_Ser-Thr	1	75	1.2e-15	58.2
LXL04_005965	`PF00069.32`	Pkinase	128	179	2e-34	119.9
LXL04_005965	`PF07714.24`	PK_Tyr_Ser-Thr	134	173	1.2e-15	58.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card