LXL04_005959 | RubberDandelionOmics

Gene overview

LXL04_005959

Reference: OH-1004 Chr: Chr01 Coordinates: 176367527-176372388 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3171 bp · LXL04_005959|LXL04_005959|OH1004|cDNA

ATGGATAATTTCCACATATACGAAGCCATCGGCCAAGGAAAATACTCCACGGTATACAAagggaggaagaagaaaagcGTTGAATATTTCGCAATCAAAAGCGTTGATAAATCCCATAAGAGCAAGGTTCTTCAGGAAGTTAGAATTCTTCACTCTTTGGATAATTCTAATGTACTCAAATTTTATGCTTGGTATGAGACTTCTGCTCATTTGTGGTTGATTTTAGAATACTGTGTTGGAGGTGACCTCCGTACATTACT...

CDS

Download CDS FASTA

3171 bp · LXL04_005959|LXL04_005959|OH1004|CDS

ATGGATAATTTCCACATATACGAAGCCATCGGCCAAGGAAAATACTCCACGGTATACAAAGGGAGGAAGAAGAAAAGCGTTGAATATTTCGCAATCAAAAGCGTTGATAAATCCCATAAGAGCAAGGTTCTTCAGGAAGTTAGAATTCTTCACTCTTTGGATAATTCTAATGTACTCAAATTTTATGCTTGGTATGAGACTTCTGCTCATTTGTGGTTGATTTTAGAATACTGTGTTGGAGGTGACCTCCGTACATTACT...

Protein

Download Protein FASTA

1056 aa · LXL04_005959|LXL04_005959|OH1004|PROTEIN

MDNFHIYEAIGQGKYSTVYKGRKKKSVEYFAIKSVDKSHKSKVLQEVRILHSLDNSNVLKFYAWYETSAHLWLILEYCVGGDLRTLLEQDSKLPEDSVHDLARDLVRGLRYLHSKGIIYCDLKPSNILLDENGRTKLCDFGLSRKLSDISKTPSSLLPQAKRGTPCYMAPELFHDGGVHSYASDLWALGCVLYECYAGRPPFIGKEFTQLVKCILTDPTPSLPGNPSRPFANLVSSLLIKDPTDRIQWSEICTHAYWRTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005959`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005959

Location Chr01:176367527-176372388 (-)

Description Similar to RUK: Serine/threonine-protein kinase RUNKEL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18700`	Essential protein that regulates phragmoplast microtubule organization during cell plate expansion in cytokinesis during cell division, both somatic and syncytial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005959 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0000914 phragmoplast assembly Biological Process

GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process

GO:0007224 smoothened signaling pathway Biological Process

GO:0007349 cellularization Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0010245 radial microtubular system formation Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010467 gene expression Biological Process

KEGG gene cross-reference

ath:AT5G18700

hsa:54986

mmu:209012

pon:100173957

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · LXL04_005959 · OH-1004

Nucleus0.318

Rank 2 · LXL04_005959 · OH-1004

Golgi apparatus0.094

Rank 3 · LXL04_005959 · OH-1004

Cell membrane0.087

Rank 4 · LXL04_005959 · OH-1004

Lysosome / Vacuole0.068

Rank 5 · LXL04_005959 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase4-256 aa

PF07714.24PK_Tyr_Ser-Thr5-252 aa

PF03109.23ABC166-149 aa

PF23606.2HEAT_ULK4864-1049 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005959	`PF00069.32`	Pkinase	4	256	2.5e-65	221.2
LXL04_005959	`PF07714.24`	PK_Tyr_Ser-Thr	5	252	7.9e-41	140.8
LXL04_005959	`PF03109.23`	ABC1	66	149	5.6e-07	29.7
LXL04_005959	`PF23606.2`	HEAT_ULK4	864	1049	4.2e-58	196.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JY37`	Arabidopsis thaliana	Serine/threonine-protein kinase RUNKEL	59.484%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card