LXL04_005929 | RubberDandelionOmics

Gene overview

LXL04_005929

Reference: OH-1004 Chr: Chr01 Coordinates: 175871285-175874519 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

888 bp · LXL04_005929|LXL04_005929|OH1004|cDNA

ATGCTGACGTGTATAACGTGCTCAAAGCAGCAGGTAGACGATGGAGGCGAGGAAGTGGGGGCGCGTGGGACACCCGCCACCAAAGACGCCGTCAAAAATCTCACTACACAGATGAAGGACATGGCGTTAAAAGTTTCCGGTTCTTCAAAAGGAAAACCACCCACCGGTCCAAGCAACAAAAACTATTACAAACCCTACACGGACTTCGACGCAATATCTAAATCAATAAAGTATCCGGAAAGTTCAACTTCAGTCCCTCC...

CDS

Download CDS FASTA

888 bp · LXL04_005929|LXL04_005929|OH1004|CDS

ATGCTGACGTGTATAACGTGCTCAAAGCAGCAGGTAGACGATGGAGGCGAGGAAGTGGGGGCGCGTGGGACACCCGCCACCAAAGACGCCGTCAAAAATCTCACTACACAGATGAAGGACATGGCGTTAAAAGTTTCCGGTTCTTCAAAAGGAAAACCACCCACCGGTCCAAGCAACAAAAACTATTACAAACCCTACACGGACTTCGACGCAATATCTAAATCAATAAAGTATCCGGAAAGTTCAACTTCAGTCCCTCC...

Protein

Download Protein FASTA

295 aa · LXL04_005929|LXL04_005929|OH1004|PROTEIN

MLTCITCSKQQVDDGGEEVGARGTPATKDAVKNLTTQMKDMALKVSGSSKGKPPTGPSNKNYYKPYTDFDAISKSIKYPESSTSVPPVWDFNSNSGGYEPPRQSGHLVLDDDDDPIEWMAQVEPGVQITFVSLPNGGNDLKRIRFNREMFDKWQAQRWWGENYDRIMELYNVQRFNCQALDTPSRSEDGGRESCYSKVGSVKESPMMRNHNSYYNAGDASRTTTSSRDEVSVSNASDVDSEWIEEDEPGVYITIRQLVDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005929`
TK1151 ID	TkA01G006560
OH-1004 ID	LXL04_005929
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005929

Location Chr01:175871285-175874519 (+)

Description Similar to BRX: Protein BREVIS RADIX

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31880`	Acts as a regulator of cell proliferation and elongation in the root and shoot.	No verified direct reference in this release
`At2g35600`	May act as a regulator of cell proliferation and elongation in the root.	Characterization of the plant-specific BREVIS RADIX gene family reveals limited genetic redundancy despite high sequence conservation.2006 · DOI: 10.1104/pp.105.075382
`At1g54180`	Protein Brevis radix-like 3.	No verified direct reference in this release
`At3g14000`	Protein Brevis radix-like 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0700700`	Protein Brevis radix-like 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005929 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048364 root development Biological Process

GO:0048527 lateral root development Biological Process

GO:0048756 sieve cell differentiation Biological Process

GO:2000280 regulation of root development Biological Process

KEGG gene cross-reference

ath:AT1G31880

ath:AT1G54180

ath:AT2G35600

ath:AT3G14000

dosa:Os02g0700700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.355

Rank 1 · LXL04_005929 · OH-1004

Nucleus0.319

Rank 2 · LXL04_005929 · OH-1004

Cell membrane0.300

Rank 3 · LXL04_005929 · OH-1004

Plastid0.193

Rank 4 · LXL04_005929 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_005929 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13713.12BRX_N24-47 aa

PF08381.17BRX117-170 aa

PF08381.17BRX240-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005929	`PF13713.12`	BRX_N	24	47	6.4e-08	32.9
LXL04_005929	`PF08381.17`	BRX	117	170	2.4e-52	174.9
LXL04_005929	`PF08381.17`	BRX	240	294	2.4e-52	174.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q17TI5`	Arabidopsis thaliana	Protein BREVIS RADIX	57.880%	Swiss-Prot	strong database homology
`O82281`	Arabidopsis thaliana	Protein Brevis radix-like 1	57.530%	Swiss-Prot	strong database homology
`Q5HZ09`	Arabidopsis thaliana	Protein Brevis radix-like 3	48.404%	Swiss-Prot	moderate database homology
`Q8GYL9`	Arabidopsis thaliana	Protein Brevis radix-like 2	44.000%	Swiss-Prot	moderate database homology
`Q6ZIK7`	Oryza sativa subsp. japonica	Protein Brevis radix-like 2	40.964%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card