LXL04_005928 | RubberDandelionOmics

Gene overview

LXL04_005928

Reference: OH-1004 Chr: Chr01 Coordinates: 175866304-175868021 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · LXL04_005928|LXL04_005928|OH1004|cDNA

ATGTTTGTGACTGAACAACTCGAAATCGCTAAAAATCAACAAAACTGCTTAAATCCCGTCACCATTTTCACCAACTTTTCACACCAAAACACTCCACCACCGCTTGATTTCGAAGCCCACAACACACTCCCTCCGCCACGACTAAACCCGCCGAAAAAGTTCAAGATTTGCCCTTCTAATTTCACCCATTACTGCCCTTGTCAAGACCCACAAAGAGAAAGACTGTTTAAAGTCGAGAGAATGTTGCACAGGGAGCGTCA...

CDS

Download CDS FASTA

633 bp · LXL04_005928|LXL04_005928|OH1004|CDS

ATGTTTGTGACTGAACAACTCGAAATCGCTAAAAATCAACAAAACTGCTTAAATCCCGTCACCATTTTCACCAACTTTTCACACCAAAACACTCCACCACCGCTTGATTTCGAAGCCCACAACACACTCCCTCCGCCACGACTAAACCCGCCGAAAAAGTTCAAGATTTGCCCTTCTAATTTCACCCATTACTGCCCTTGTCAAGACCCACAAAGAGAAAGACTGTTTAAAGTCGAGAGAATGTTGCACAGGGAGCGTCA...

Protein

Download Protein FASTA

210 aa · LXL04_005928|LXL04_005928|OH1004|PROTEIN

MFVTEQLEIAKNQQNCLNPVTIFTNFSHQNTPPPLDFEAHNTLPPPRLNPPKKFKICPSNFTHYCPCQDPQRERLFKVERMLHRERHCPATVGEILRCLVPEPVGYKKPFPWPKSRAQAWFSNVAFKTLTESKKQQNWVRLVGDRLVFPSGGTSFQKGVKGYIDQLNKMMPLESGAFRTVLDTGCGVSKCDCSFIKILNIYVVLTLLNSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005928`
TK1151 ID	TkA01G006650
OH-1004 ID	LXL04_005928
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 61.905 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005928

Location Chr01:175866304-175868021 (-)

Description Similar to At2g43200: Probable methyltransferase PMT19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43200`	Probable methyltransferase PMT19.	No verified direct reference in this release
`At2g45750`	Probable methyltransferase PMT16.	No verified direct reference in this release
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005928 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G33170

ath:AT2G43200

ath:AT2G45750

ath:AT4G00750

ath:AT4G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.289

Rank 1 · LXL04_005928 · OH-1004

Endoplasmic reticulum0.278

Rank 2 · LXL04_005928 · OH-1004

Cytoplasm0.139

Rank 3 · LXL04_005928 · OH-1004

Golgi apparatus0.128

Rank 4 · LXL04_005928 · OH-1004

Nucleus0.115

Rank 5 · LXL04_005928 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_2964-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005928	`PF03141.23`	Methyltransf_29	64	190	4e-46	158.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW75`	Arabidopsis thaliana	Probable methyltransferase PMT19	58.170%	Swiss-Prot	strong database homology
`O80844`	Arabidopsis thaliana	Probable methyltransferase PMT16	42.473%	Swiss-Prot	moderate database homology
`Q9ZPH9`	Arabidopsis thaliana	Probable methyltransferase PMT15	46.108%	Swiss-Prot	moderate database homology
`Q9SZX8`	Arabidopsis thaliana	Probable methyltransferase PMT17	44.172%	Swiss-Prot	moderate database homology
`Q9C884`	Arabidopsis thaliana	Probable methyltransferase PMT18	43.976%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card