LXL04_005920 | RubberDandelionOmics

Gene overview

LXL04_005920

Reference: OH-1004 Chr: Chr01 Coordinates: 175722075-175735194 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3453 bp · LXL04_005920|LXL04_005920|OH1004|cDNA

ATGAACTGGTCGTTAATGGAGATGGAGAAGCAATCAATTTCAGGAGGCGTTAATGGCAGAAATCGATTTCAACAGATGCCGATTACAGGGATGGAAAAGAGGGCAGATCGAACCATTAATGGCGCCGCTTCAGAGAGGCAGAGCGTCGATGATGGCGTCGAAAtaTCACAAGGAGATCTAATGGGTCCAGCAAAAAAGTCTAGAAGTGTGAACAAGCGATTCTCATATGGTAATGAGATACCTCCAACTAAAGATGCAGA...

CDS

Download CDS FASTA

3453 bp · LXL04_005920|LXL04_005920|OH1004|CDS

ATGAACTGGTCGTTAATGGAGATGGAGAAGCAATCAATTTCAGGAGGCGTTAATGGCAGAAATCGATTTCAACAGATGCCGATTACAGGGATGGAAAAGAGGGCAGATCGAACCATTAATGGCGCCGCTTCAGAGAGGCAGAGCGTCGATGATGGCGTCGAAATATCACAAGGAGATCTAATGGGTCCAGCAAAAAAGTCTAGAAGTGTGAACAAGCGATTCTCATATGGTAATGAGATACCTCCAACTAAAGATGCAGA...

Protein

Download Protein FASTA

1150 aa · LXL04_005920|LXL04_005920|OH1004|PROTEIN

MNWSLMEMEKQSISGGVNGRNRFQQMPITGMEKRADRTINGAASERQSVDDGVEISQGDLMGPAKKSRSVNKRFSYGNEIPPTKDADNTYKKNQRVALLLTLKMNVFIYLNAVTMLCFTRIQLVIIMSFKLQLYAFANRSRSKKKLSDMLGPHWSKEELEHFYEAYRKHGRDWKKVAAVLHNRSMEMVEAVYSLNRAYLSLPEGTASVAGFIAMMTDYYSNMTLTFPFFFFPPNFSYNNLTNIVKSVFWNVRVKWSLVIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005920`
TK1151 ID	TkA01G007190
OH-1004 ID	LXL04_005920
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	75.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005920

Location Chr01:175722075-175735194 (-)

Description Similar to ALY3: Protein ALWAYS EARLY 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21430`	Protein ALWAYS EARLY 3.	No verified direct reference in this release
`At3g05380`	Protein ALWAYS EARLY 2.	No verified direct reference in this release
`At5g27610`	Protein ALWAYS EARLY 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005920 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0070176 DRM complex Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G05380

ath:AT3G21430

ath:AT5G27610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_005920 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_005920 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_005920 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_005920 · OH-1004

Plastid0.017

Rank 5 · LXL04_005920 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding153-188 aa

PF06584.19DIRP687-787 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005920	`PF00249.38`	Myb_DNA-binding	153	188	2.4e-09	37.9
LXL04_005920	`PF06584.19`	DIRP	687	787	4.9e-31	107.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6A332`	Arabidopsis thaliana	Protein ALWAYS EARLY 3	40.069%	Swiss-Prot	moderate database homology
`Q6A333`	Arabidopsis thaliana	Protein ALWAYS EARLY 2	69.942%	Swiss-Prot	weak database homology
`Q6A331`	Arabidopsis thaliana	Protein ALWAYS EARLY 1	68.208%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card