LXL04_005905 | RubberDandelionOmics

Gene overview

LXL04_005905

Reference: OH-1004 Chr: Chr01 Coordinates: 175531209-175536672 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2664 bp · LXL04_005905|LXL04_005905|OH1004|cDNA

ATGGATTTGGGAATTAAAGAAAGTTTAGCCAATGCGTTGAAACAAAGCCGATATCATGCGAAAAGATGCTTTGACCGCTTTACATCACGTGGGAGACGATTAGTGAAACCCCAAGAATTGATTTATGCAATCGAAAAAACCATAGATGACGAGCTTGAAAGAACCAAGGTTTTGGAGGGTTCATTAGGTCAAATATTGAGGTCTACGGAGGAGGCTGTAGTAATTCCACCAAATGTGGTATTGGCGGTAAGAGGAAGTCC...

CDS

Download CDS FASTA

2664 bp · LXL04_005905|LXL04_005905|OH1004|CDS

ATGGATTTGGGAATTAAAGAAAGTTTAGCCAATGCGTTGAAACAAAGCCGATATCATGCGAAAAGATGCTTTGACCGCTTTACATCACGTGGGAGACGATTAGTGAAACCCCAAGAATTGATTTATGCAATCGAAAAAACCATAGATGACGAGCTTGAAAGAACCAAGGTTTTGGAGGGTTCATTAGGTCAAATATTGAGGTCTACGGAGGAGGCTGTAGTAATTCCACCAAATGTGGTATTGGCGGTAAGAGGAAGTCC...

Protein

Download Protein FASTA

887 aa · LXL04_005905|LXL04_005905|OH1004|PROTEIN

MDLGIKESLANALKQSRYHAKRCFDRFTSRGRRLVKPQELIYAIEKTIDDELERTKVLEGSLGQILRSTEEAVVIPPNVVLAVRGSPGRWEYLKVNADDVTVHALTPTQYLTLKESIYRANDEDTLDVDFGAFDFCMPRLTLPSSIGNGFHYISKFATSRLDGDLENAKPLLDHLLTLNHGGEKLMINETLDSISKLQKALIVADVYLSAHQKDEPWRTFEHKLKEWGFEKGWGDSAKKVKETMKMLSEILQAPDPSNME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005905`
TK1151 ID	TkA01G007940
OH-1004 ID	LXL04_005905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005905

Location Chr01:175531209-175536672 (+)

Description Similar to SUS6: Sucrose synthase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73370`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106
`At5g37180`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0249500`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release
`Os04g0309600`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release
`Os02g0831500`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0080165 callose deposition in phloem sieve plate Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016157 sucrose synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73370

dosa:Os02g0831500

dosa:Os04g0249500

dosa:Os04g0309600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.316

Rank 1 · LXL04_005905 · OH-1004

Mitochondrion0.225

Rank 2 · LXL04_005905 · OH-1004

Endoplasmic reticulum0.199

Rank 3 · LXL04_005905 · OH-1004

Nucleus0.159

Rank 4 · LXL04_005905 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_005905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24861.3SUS_N5-115 aa

PF24862.2SUS_EPBD148-235 aa

PF00862.27GT-B_Sucrose_synth258-546 aa

PF00534.27Glycos_transf_1557-721 aa

PF13692.13Glyco_trans_1_4564-719 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005905	`PF24861.3`	SUS_N	5	115	3.2e-39	134.4
LXL04_005905	`PF24862.2`	SUS_EPBD	148	235	3.4e-27	95.4
LXL04_005905	`PF00862.27`	GT-B_Sucrose_synth	258	546	3e-166	552.2
LXL04_005905	`PF00534.27`	Glycos_transf_1	557	721	6e-30	104.8
LXL04_005905	`PF13692.13`	Glyco_trans_1_4	564	719	2.6e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX32`	Arabidopsis thaliana	Sucrose synthase 6	70.088%	Swiss-Prot	strong database homology
`F4K5W8`	Arabidopsis thaliana	Sucrose synthase 5	67.047%	Swiss-Prot	strong database homology
`Q7XNX6`	Oryza sativa subsp. japonica	Sucrose synthase 7	67.506%	Swiss-Prot	strong database homology
`H6TFZ4`	Oryza sativa subsp. japonica	Sucrose synthase 5	67.254%	Swiss-Prot	strong database homology
`Q6K973`	Oryza sativa subsp. japonica	Sucrose synthase 6	64.799%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card