LXL04_005896 | RubberDandelionOmics

Gene overview

LXL04_005896

Reference: OH-1004 Chr: Chr01 Coordinates: 175341852-175352148 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5595 bp · LXL04_005896|LXL04_005896|OH1004|cDNA

ATGGGGAGACAATTCATGTGGGGCCATGTGGTAATATCAGCAGCATTAATGGCGGGCCATGTGGTAGTTGCTGACTTGCATTTGTATTTTCCACACGCATTGCAATGGCTGCAATCTCCTTTTCTCTCTCCACTTCTTCTCTTTTGGCTTCAAGCTAATTTAAAAAGCCTGTCAGAGTTTGATACTACTCCCTATCTCTATCTTCATCACAAACAACAAATCGGTGAAGACGAATCCCTCTTTCTACTGGCTCGCAGCTC...

CDS

Download CDS FASTA

5595 bp · LXL04_005896|LXL04_005896|OH1004|CDS

ATGGGGAGACAATTCATGTGGGGCCATGTGGTAATATCAGCAGCATTAATGGCGGGCCATGTGGTAGTTGCTGACTTGCATTTGTATTTTCCACACGCATTGCAATGGCTGCAATCTCCTTTTCTCTCTCCACTTCTTCTCTTTTGGCTTCAAGCTAATTTAAAAAGCCTGTCAGAGTTTGATACTACTCCCTATCTCTATCTTCATCACAAACAACAAATCGGTGAAGACGAATCCCTCTTTCTACTGGCTCGCAGCTC...

Protein

Download Protein FASTA

1864 aa · LXL04_005896|LXL04_005896|OH1004|PROTEIN

MGRQFMWGHVVISAALMAGHVVVADLHLYFPHALQWLQSPFLSPLLLFWLQANLKSLSEFDTTPYLYLHHKQQIGEDESLFLLARSSISKFQVHQSAFVELYFDGQKYRTTVKEKDLDPIWNESFHFNISDPTILPNLTLDAFIYNNVKDTNSRSFLGKVSITGTSFVPYSDAVVLHYPLEKRGIFSRVRGELGLKVYVTDDPSIKTSDPVAKSVHEPVKNSEKRHTFHHLPHQTQAPANTGVPQAPPPAMRYGYEQIKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005896`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005896

Location Chr01:175341852-175352148 (+)

Description Similar to FTIP7: FT-interacting protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11610`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At3g57880`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At1g51570`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At5g12970`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0370600`	Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005896 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

GO:1902182 shoot apical meristem development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G51570

ath:AT3G57880

ath:AT4G11610

ath:AT5G12970

dosa:Os05g0370600

osa:4338582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.275

Rank 1 · LXL04_005896 · OH-1004

Endoplasmic reticulum0.267

Rank 2 · LXL04_005896 · OH-1004

Cell membrane0.186

Rank 3 · LXL04_005896 · OH-1004

Plastid0.125

Rank 4 · LXL04_005896 · OH-1004

Nucleus0.102

Rank 5 · LXL04_005896 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C294-166 aa

PF00168.37C2321-424 aa

PF00168.37C2484-588 aa

PF00168.37C2645-754 aa

PF08372.17PRT_C883-1014 aa

PF03016.21Exostosin_GT471219-1549 aa

PF00255.26GSHPx1702-1810 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005896	`PF00168.37`	C2	94	166	2.1e-79	263.2
LXL04_005896	`PF00168.37`	C2	321	424	2.1e-79	263.2
LXL04_005896	`PF00168.37`	C2	484	588	2.1e-79	263.2
LXL04_005896	`PF00168.37`	C2	645	754	2.1e-79	263.2
LXL04_005896	`PF08372.17`	PRT_C	883	1014	8.3e-60	201.8
LXL04_005896	`PF03016.21`	Exostosin_GT47	1219	1549	7.7e-78	262.5
LXL04_005896	`PF00255.26`	GSHPx	1702	1810	2.3e-42	143.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TJ7`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 7	69.784%	Swiss-Prot	weak database homology
`Q9M2R0`	Arabidopsis thaliana	FT-interacting protein 3	66.495%	Swiss-Prot	weak database homology
`Q9C8H3`	Arabidopsis thaliana	FT-interacting protein 4	64.653%	Swiss-Prot	weak database homology
`Q9LXU2`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 5	65.486%	Swiss-Prot	weak database homology
`Q60EW9`	Oryza sativa subsp. japonica	FT-interacting protein 7	67.368%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card