LXL04_005788 | RubberDandelionOmics

Gene overview

LXL04_005788

Reference: OH-1004 Chr: Chr01 Coordinates: 173431618-173432898 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

225 bp · LXL04_005788|LXL04_005788|OH1004|cDNA

ATGGCGACCTCGAAGTTTCCGTCCGATGTGGTGTCGGCATTTGCTCTCATTTTCGCCATCGCATTTCCCGCCGCCGTTCACGGCCAGCCTTTGGCTCCGGCTCCAGCACCTGCCAGCGACGGGACATCAATAGATCAAGGAATAGCATATTTGTTGATGTTGGTAGCTTTGGTGCTCACATATTTCATACACAGTTTGGATTCTCCCGTTACAGTTATCAGCTGA

CDS

Download CDS FASTA

225 bp · LXL04_005788|LXL04_005788|OH1004|CDS

ATGGCGACCTCGAAGTTTCCGTCCGATGTGGTGTCGGCATTTGCTCTCATTTTCGCCATCGCATTTCCCGCCGCCGTTCACGGCCAGCCTTTGGCTCCGGCTCCAGCACCTGCCAGCGACGGGACATCAATAGATCAAGGAATAGCATATTTGTTGATGTTGGTAGCTTTGGTGCTCACATATTTCATACACAGTTTGGATTCTCCCGTTACAGTTATCAGCTGA

Protein

Download Protein FASTA

74 aa · LXL04_005788|LXL04_005788|OH1004|PROTEIN

MATSKFPSDVVSAFALIFAIAFPAAVHGQPLAPAPAPASDGTSIDQGIAYLLMLVALVLTYFIHSLDSPVTVIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005788`
TK1151 ID	TkA01G015620
OH-1004 ID	LXL04_005788
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 29.747 / OH-1004 63.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005788

Location Chr01:173431618-173432898 (+)

Description Similar to AGP20: Arabinogalactan protein 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61640`	Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.	No verified direct reference in this release
`At5g53250`	Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.	No verified direct reference in this release
`At2g46330`	Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.	No verified direct reference in this release
`At5g24105`	Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005788 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT2G46330

ath:AT3G61640

ath:AT5G24105

ath:AT5G53250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.619

Rank 1 · LXL04_005788 · OH-1004

Endoplasmic reticulum0.200

Rank 2 · LXL04_005788 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_005788 · OH-1004

Extracellular0.063

Rank 4 · LXL04_005788 · OH-1004

Lysosome / Vacuole0.055

Rank 5 · LXL04_005788 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06376.18AGP32-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005788	`PF06376.18`	AGP	32	64	3.6e-18	65.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M373`	Arabidopsis thaliana	Arabinogalactan protein 20	67.797%	Swiss-Prot	strong database homology
`Q9FK16`	Arabidopsis thaliana	Arabinogalactan protein 22	59.375%	Swiss-Prot	strong database homology
`O82337`	Arabidopsis thaliana	Arabinogalactan protein 16	69.091%	Swiss-Prot	strong database homology
`Q8L9T8`	Arabidopsis thaliana	Arabinogalactan protein 41	60.938%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card