LXL04_005748 | RubberDandelionOmics

Gene overview

LXL04_005748

Reference: OH-1004 Chr: Chr01 Coordinates: 172655974-172657716 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · LXL04_005748|LXL04_005748|OH1004|cDNA

ATGTCAGTTGCTGACGTTGCTTTGAGTCCAATTCACAAAAGGCCCGGCTCCGTTTGTTCACGGAGCAGTGAATCCATCGTGATTTACTTAACAATTGCAGGTTCCGTGATTCCAATGAGAATTATGGAATCCGATTCCATTGCCACCGTGAAACTAAGGATTCAGACGTGTAAAGGATTTGTAGTGAAGAAACAAAAGCTTGTTTTCGAAGGGAGAGAATTATCAAGAAATAATTCTCTTTTGAAAGACTATGGTGTTTC...

CDS

Download CDS FASTA

1644 bp · LXL04_005748|LXL04_005748|OH1004|CDS

ATGTCAGTTGCTGACGTTGCTTTGAGTCCAATTCACAAAAGGCCCGGCTCCGTTTGTTCACGGAGCAGTGAATCCATCGTGATTTACTTAACAATTGCAGGTTCCGTGATTCCAATGAGAATTATGGAATCCGATTCCATTGCCACCGTGAAACTAAGGATTCAGACGTGTAAAGGATTTGTAGTGAAGAAACAAAAGCTTGTTTTCGAAGGGAGAGAATTATCAAGAAATAATTCTCTTTTGAAAGACTATGGTGTTTC...

Protein

Download Protein FASTA

547 aa · LXL04_005748|LXL04_005748|OH1004|PROTEIN

MSVADVALSPIHKRPGSVCSRSSESIVIYLTIAGSVIPMRIMESDSIATVKLRIQTCKGFVVKKQKLVFEGRELSRNNSLLKDYGVSSGDVLHLILRVSDLLMITVDTAIGKAFEFEVDRFRNVKYLKELVEEKAKGIGFVNGEDLKILCNGEKLDDERLIDDICKNHDAVIHLVVQKSSPYERNPKKDEKKTNPKKPPDIDFPLQPIVVNPDSKLSPDISNMLDSASEGLQKGKKPIISSEGTGGTYFMQHPSGNKYVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005748`
TK1151 ID	TkA01G019180
OH-1004 ID	LXL04_005748
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005748

Location Chr01:172655974-172657716 (+)

Description Similar to PI4KG2: Phosphatidylinositol 4-kinase gamma 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9SGW8`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At2g46500`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).	Characterization of a new family of protein kinases from Arabidopsis containing phosphoinositide 3/4-kinase and ubiquitin-like domains.2008 · DOI: 10.1042/bj20070959
`At5g24240`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At1g13640`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0290500`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005748 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0048364 root development Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0050821 protein stabilization Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

KEGG gene cross-reference

ath:AT1G13640

ath:AT2G46500

ath:AT5G24240

dosa:Os02g0290500

osa:4329058

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.396

Rank 1 · LXL04_005748 · OH-1004

Nucleus0.283

Rank 2 · LXL04_005748 · OH-1004

Cell membrane0.231

Rank 3 · LXL04_005748 · OH-1004

Endoplasmic reticulum0.131

Rank 4 · LXL04_005748 · OH-1004

Golgi apparatus0.108

Rank 5 · LXL04_005748 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin33-98 aa

PF11976.15Rad60-SLD35-96 aa

PF00240.30ubiquitin104-178 aa

PF00454.34PI3_PI4_kinase244-491 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005748	`PF00240.30`	ubiquitin	33	98	1.9e-22	79.5
LXL04_005748	`PF11976.15`	Rad60-SLD	35	96	2.2e-07	31.3
LXL04_005748	`PF00240.30`	ubiquitin	104	178	1.9e-22	79.5
LXL04_005748	`PF00454.34`	PI3_PI4_kinase	244	491	2.2e-44	152.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGW8`	Arabidopsis thaliana	Phosphatidylinositol 4-kinase gamma 2	57.168%	Swiss-Prot	strong database homology
`Q9ZPY9`	Arabidopsis thaliana	Phosphatidylinositol 4-kinase gamma 4	56.514%	Swiss-Prot	strong database homology
`Q9FNF8`	Arabidopsis thaliana	Phosphatidylinositol 4-kinase gamma 3	54.593%	Swiss-Prot	strong database homology
`Q8W4R8`	Arabidopsis thaliana	Phosphatidylinositol 4-kinase gamma 6	40.909%	Swiss-Prot	weak database homology
`Q6K881`	Oryza sativa subsp. japonica	Phosphatidylinositol 4-kinase gamma 4	54.128%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card