LXL04_005729 | RubberDandelionOmics

Gene overview

LXL04_005729

Reference: OH-1004 Chr: Chr01 Coordinates: 172249450-172252351 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1653 bp · LXL04_005729|LXL04_005729|OH1004|cDNA

ATGGCTTCTGGAGTGGGTTTTTTGGTACATGAGAGTGATTTGCTTGCGAAACTGAGCCTGAATTCAACACCGGAACCAGAGCTTGAAGATGCTAATGTTTTGGAACGATGCCCTAACAATCGTTACATTCGGTATAATGAAATGCTGGGGAGAGGAGCATTCAAGACTGTATACAAAGGATTTGATGAAGTTGAAGGAATTGAAATTGCCTGGAACCAAGTAAGGCTAGATGACGCCATGCAATCTCCAGAACATCTGGA...

CDS

Download CDS FASTA

1653 bp · LXL04_005729|LXL04_005729|OH1004|CDS

ATGGCTTCTGGAGTGGGTTTTTTGGTACATGAGAGTGATTTGCTTGCGAAACTGAGCCTGAATTCAACACCGGAACCAGAGCTTGAAGATGCTAATGTTTTGGAACGATGCCCTAACAATCGTTACATTCGGTATAATGAAATGCTGGGGAGAGGAGCATTCAAGACTGTATACAAAGGATTTGATGAAGTTGAAGGAATTGAAATTGCCTGGAACCAAGTAAGGCTAGATGACGCCATGCAATCTCCAGAACATCTGGA...

Protein

Download Protein FASTA

550 aa · LXL04_005729|LXL04_005729|OH1004|PROTEIN

MASGVGFLVHESDLLAKLSLNSTPEPELEDANVLERCPNNRYIRYNEMLGRGAFKTVYKGFDEVEGIEIAWNQVRLDDAMQSPEHLERVYSEVHLLRTLKHENIIKSYASWVDNEKKTINMMTELFTSGSLRQYRKKHKSVDLKAIKNWARQILKGLVYLHSNDPPIIHRDLKCDNIFVNGNHGEVKIGDLGLATLMLRPTAKSLLGTPEFMAPELYEEEYNELVDIYSFGMCLLELITCEYPYSECINQAQIYRKVSTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005729`
TK1151 ID	TkA01G020460
OH-1004 ID	LXL04_005729
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005729

Location Chr01:172249450-172252351 (-)

Description Similar to WNK8: Serine/threonine-protein kinase WNK8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41990`	Regulates flowering time by modulating the photoperiod pathway.	A WNK kinase binds and phosphorylates V-ATPase subunit C.2006 · DOI: 10.1016/j.febslet.2006.01.018 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x The Arabidopsis defense component EDM2 affects the floral transition in an FLC-dependent manner.2010 · DOI: 10.1111/j.1365-313x.2010.04169.x Co-option of EDM2 to distinct regulatory modules in Arabidopsis thaliana development.2010 · DOI: 10.1186/1471-2229-10-203
`At1g64630`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At1g49160`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g18750`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0672800`	Probable serine/threonine-protein kinase WNK4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005729 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G49160

ath:AT1G64630

ath:AT3G18750

ath:AT5G41990

dosa:Os02g0672800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_005729 · OH-1004

Nucleus0.390

Rank 2 · LXL04_005729 · OH-1004

Cell membrane0.168

Rank 3 · LXL04_005729 · OH-1004

Golgi apparatus0.063

Rank 4 · LXL04_005729 · OH-1004

Lysosome / Vacuole0.061

Rank 5 · LXL04_005729 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr44-284 aa

PF00069.32Pkinase46-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005729	`PF07714.24`	PK_Tyr_Ser-Thr	44	284	4.5e-36	125.2
LXL04_005729	`PF00069.32`	Pkinase	46	300	7.2e-51	173.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944Q0`	Arabidopsis thaliana	Serine/threonine-protein kinase WNK8	50.342%	Swiss-Prot	strong database homology
`Q8RXE5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK10	49.533%	Swiss-Prot	moderate database homology
`Q8LST2`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK7	55.333%	Swiss-Prot	strong database homology
`Q8S8Y8`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK6	54.897%	Swiss-Prot	strong database homology
`Q6EU49`	Oryza sativa subsp. japonica	Probable serine/threonine-protein kinase WNK4	57.237%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card