Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1971 bp · LXL04_005641|LXL04_005641|OH1004|cDNA
ATGGCTGAGGAAGCACATTATTCGTCCGGAGCGGACTACGCCACCACGAAGCGTAAGTACGATGACTCTGCTACCCCACCTCCGCCCTCATCTGGCCGTCGAGCCACTGGATTTTCCGCACCCATCATTCCTTCACAGTCTCCTGACTCCGCACCGGCGTACAACAACGTACCTCCACCGGCAGATGAGATCGAACTCGCTAAACAGAAGGCTCAGGAGATCGCTGCTCGTCTCTTCAACACCGCCGAGGCCGAAGTTCG...
1971 bp · LXL04_005641|LXL04_005641|OH1004|CDS
ATGGCTGAGGAAGCACATTATTCGTCCGGAGCGGACTACGCCACCACGAAGCGTAAGTACGATGACTCTGCTACCCCACCTCCGCCCTCATCTGGCCGTCGAGCCACTGGATTTTCCGCACCCATCATTCCTTCACAGTCTCCTGACTCCGCACCGGCGTACAACAACGTACCTCCACCGGCAGATGAGATCGAACTCGCTAAACAGAAGGCTCAGGAGATCGCTGCTCGTCTCTTCAACACCGCCGAGGCCGAAGTTCG...
Protein
Download Protein FASTA656 aa · LXL04_005641|LXL04_005641|OH1004|PROTEIN
MAEEAHYSSGADYATTKRKYDDSATPPPPSSGRRATGFSAPIIPSQSPDSAPAYNNVPPPADEIELAKQKAQEIAARLFNTAEAEVRKRPKFENGGGGGGYDSNDNKGFSSGPTDYSQRPYSATASVSSAYGYGSPGKKIDIPNGRVGVIIGKGGETIKYLQLQSGAKIQVTRDMDADPHSLTRTVELTGSSESVAKAEQLIKDVLAEAESGGSGIVSRRMPGESGGAEQFVMKVPNNKVGLIIGKGGETIKSMQANTGA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005641 |
|---|---|
| TK1151 ID | TkA01G030370 |
| OH-1004 ID | LXL04_005641 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 95.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005641 |
|---|---|
| Location | Chr01:169720693-169724334 (-) |
| Description | Similar to KHSRP: Far upstream element-binding protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000375 RNA splicing, via transesterification reactions Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0008380 RNA splicing Biological Process GO:0010586 miRNA metabolic process Biological Process GO:0010989 negative regulation of low-density lipoprotein particle clearance Biological Process GO:0043488 regulation of mRNA stability Biological Process GO:0045019 negative regulation of nitric oxide biosynthetic process Biological Process GO:0051028 mRNA transport Biological Process GO:0061014 positive regulation of mRNA catabolic process Biological Process |
| KEGG gene cross-reference | hsa:8570 mmu:16549 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00013.36KH_1139-204 aaPF13083.14KH_KhpA-B226-256 aaPF00013.36KH_1232-298 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005641 | PF00013.36 | KH_1 | 139 | 204 | 1.4e-39 | 134.3 |
| LXL04_005641 | PF13083.14 | KH_KhpA-B | 226 | 256 | 7.4e-07 | 29.7 |
| LXL04_005641 | PF00013.36 | KH_1 | 232 | 298 | 1.4e-39 | 134.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.