LXL04_005446 | RubberDandelionOmics

Gene overview

LXL04_005446

Reference: OH-1004 Chr: Chr01 Coordinates: 164259538-164260646 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · LXL04_005446|LXL04_005446|OH1004|cDNA

ATGGCATCAATTCTACCTTCAATAAGCATCCTGTGTGTTCTTATACTTCATCTCACTTCTCTTACCGATGGCGGCGGTGTTGGAATCAACTACGGATTACTCGGAAACAACCTCCCTTCTCCACCCCAAGTCGTAAACCTCTTAAAATCAAGAAACATAAAACGAATTCGCATCTTTAGCCCTGACGTCAACGTTCTCAACGCTCTACAAAACTCAGGAATCGAATTAATCATCGGAACCTTCAATCAAGACATACCCAA...

CDS

Download CDS FASTA

1014 bp · LXL04_005446|LXL04_005446|OH1004|CDS

ATGGCATCAATTCTACCTTCAATAAGCATCCTGTGTGTTCTTATACTTCATCTCACTTCTCTTACCGATGGCGGCGGTGTTGGAATCAACTACGGATTACTCGGAAACAACCTCCCTTCTCCACCCCAAGTCGTAAACCTCTTAAAATCAAGAAACATAAAACGAATTCGCATCTTTAGCCCTGACGTCAACGTTCTCAACGCTCTACAAAACTCAGGAATCGAATTAATCATCGGAACCTTCAATCAAGACATACCCAA...

Protein

Download Protein FASTA

337 aa · LXL04_005446|LXL04_005446|OH1004|PROTEIN

MASILPSISILCVLILHLTSLTDGGGVGINYGLLGNNLPSPPQVVNLLKSRNIKRIRIFSPDVNVLNALQNSGIELIIGTFNQDIPNLAGDLNFAKSWVLSKIVPYQRTIKFRCISIGNEVIPGGYTNQVYPAIQHMNTALQSLSLGYIPVTTTIALNSLASSSPPSTGDFKGDVKAEMRKIASFLNYKSYPLLVNVYPYFAYASAPGSISLPYVMFTSNDVVVRDGNLGYRNMFDAMVDAVYSALEKVNAGGVEVVITE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005446`
TK1151 ID	TkA01G048980
OH-1004 ID	LXL04_005446
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.110 / OH-1004 99.110 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005446`
Location	Chr01:164259538-164260646 (+)
Description	Similar to Putative glucan endo-1,3-beta-glucosidase GVI (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005446` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006952 defense response Biological Process GO:0005773 vacuole Cellular Component GO:0042972 licheninase activity Molecular Function GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.633

Rank 1 · LXL04_005446 · OH-1004

Cell membrane0.121

Rank 2 · LXL04_005446 · OH-1004

Endoplasmic reticulum0.096

Rank 3 · LXL04_005446 · OH-1004

Cytoplasm0.088

Rank 4 · LXL04_005446 · OH-1004

Lysosome / Vacuole0.066

Rank 5 · LXL04_005446 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1727-337 aa

PF29664.1BtgE-BtgC_glyc-hydro45-165 aa

PF29664.1BtgE-BtgC_glyc-hydro238-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005446	`PF00332.25`	Glyco_hydro_17	27	337	2e-92	310.8
LXL04_005446	`PF29664.1`	BtgE-BtgC_glyc-hydro	45	165	3.8e-19	69.6
LXL04_005446	`PF29664.1`	BtgE-BtgC_glyc-hydro	238	323	3.8e-19	69.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card