LXL04_005420 | RubberDandelionOmics

Gene overview

LXL04_005420

Reference: OH-1004 Chr: Chr01 Coordinates: 163208967-163209677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · LXL04_005420|LXL04_005420|OH1004|cDNA

ATGGCGTCGTCAACGCTGATTCCGAATCCGGTAACGAACAACACAGACAGAGCACGTGATTCATCGAAAAGGAGAAAGAGAAAGAAAATCCAAAGGCAATCCAGTGGTAATGGTAGGGATCAGAGTAGTCAGAACTTGAATAACAGTAATGAACCGATTTCGCCATGGAAATCGGATGTTCAACAGCAACTTTACAGCTCGAAACTCCTGCAAGCTCTCCGTCAGGTCCGACAGAGCTCGGCTACCTCTATTAAACCTCC...

CDS

Download CDS FASTA

711 bp · LXL04_005420|LXL04_005420|OH1004|CDS

ATGGCGTCGTCAACGCTGATTCCGAATCCGGTAACGAACAACACAGACAGAGCACGTGATTCATCGAAAAGGAGAAAGAGAAAGAAAATCCAAAGGCAATCCAGTGGTAATGGTAGGGATCAGAGTAGTCAGAACTTGAATAACAGTAATGAACCGATTTCGCCATGGAAATCGGATGTTCAACAGCAACTTTACAGCTCGAAACTCCTGCAAGCTCTCCGTCAGGTCCGACAGAGCTCGGCTACCTCTATTAAACCTCC...

Protein

Download Protein FASTA

236 aa · LXL04_005420|LXL04_005420|OH1004|PROTEIN

MASSTLIPNPVTNNTDRARDSSKRRKRKKIQRQSSGNGRDQSSQNLNNSNEPISPWKSDVQQQLYSSKLLQALRQVRQSSATSIKPPRRGRAVHEAADRVLAVTAKGRTRWSRAILTNKLKLKFMRSNRKQRGMVATATGNSRLKKPRVSISRLKMKNLPAVQKKTRVLGGLVPGCRKQSLPVVLEEATDYIPALEMQVRAMTALVNLLSGGSSSTSVSGAGNLGHFSFSRPPPNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005420`
TK1151 ID	TkA01G053200
OH-1004 ID	LXL04_005420
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005420

Location Chr01:163208967-163209677 (+)

Description Similar to BHLH147: Transcription factor bHLH147

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17100`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At3g06590`	bHLH transcription factor that binds DNA on specific sequence 5'-CANNTG-3' in target gene promoters.	No verified direct reference in this release
`At1g09250`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At3g05800`	Atypical bHLH transcription factor probably unable to bind DNA.	Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins.2009 · DOI: 10.1105/tpc.109.072504

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005420 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G09250

ath:AT3G05800

ath:AT3G06590

ath:AT3G17100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_005420 · OH-1004

Cytoplasm0.063

Rank 2 · LXL04_005420 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_005420 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_005420 · OH-1004

Plastid0.018

Rank 5 · LXL04_005420 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26576.1IBH1_N60-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005420	`PF26576.1`	IBH1_N	60	120	2.4e-10	40.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSN7`	Arabidopsis thaliana	Transcription factor bHLH147	50.273%	Swiss-Prot	strong database homology
`Q9C8Z9`	Arabidopsis thaliana	Transcription factor bHLH148	51.685%	Swiss-Prot	strong database homology
`O80482`	Arabidopsis thaliana	Transcription factor bHLH149	45.912%	Swiss-Prot	moderate database homology
`Q9M9L6`	Arabidopsis thaliana	Transcription factor bHLH150	42.515%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card