LXL04_005372 | RubberDandelionOmics

Gene overview

LXL04_005372

Reference: OH-1004 Chr: Chr01 Coordinates: 161933382-161937375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_005372|LXL04_005372|OH1004|cDNA

ATGACCACACGAATGTACGTGGCGGTGGTTATCGGAGACCGGAATGCCAAAACTAATTTTCCGATCGTTAAAAAGGAGTTGTGTACTAAAATCGACGGTGGTTCAGGTTCAGGTTCAGGTTCAGGTTCTGGTTCTGGATCGCCGTCGTCTTCGGCAGCCACTTCTGCTTTTTCTGCAATGCTAAGTGCGAAGCTTCGGAAATGCTGCAAATCACCGTCGCCATCGCTAACGTGTCTCCGGCTGGATACGGAAAGTTCGCA...

CDS

Download CDS FASTA

825 bp · LXL04_005372|LXL04_005372|OH1004|CDS

ATGACCACACGAATGTACGTGGCGGTGGTTATCGGAGACCGGAATGCCAAAACTAATTTTCCGATCGTTAAAAAGGAGTTGTGTACTAAAATCGACGGTGGTTCAGGTTCAGGTTCAGGTTCAGGTTCTGGTTCTGGATCGCCGTCGTCTTCGGCAGCCACTTCTGCTTTTTCTGCAATGCTAAGTGCGAAGCTTCGGAAATGCTGCAAATCACCGTCGCCATCGCTAACGTGTCTCCGGCTGGATACGGAAAGTTCGCA...

Protein

Download Protein FASTA

274 aa · LXL04_005372|LXL04_005372|OH1004|PROTEIN

MTTRMYVAVVIGDRNAKTNFPIVKKELCTKIDGGSGSGSGSGSGSGSPSSSAATSAFSAMLSAKLRKCCKSPSPSLTCLRLDTESSHIGVWQKRAGIHSDSNWVMTVELGKNKGKAEGVTGDDIPKTAMVVPETVSSTTGTYCEEEFPKLTNSDLCSSDILNPFSRRSSSSSHICIPFSMVSSDLFSLVNGKQRYVVDYFEIGRVYNLKSISDKPRNGTTYLATSVMHADFWMDGGQWTPGSRTRYNLRDTVTSGCGTSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005372`
TK1151 ID	TkA01G060100
OH-1004 ID	LXL04_005372
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.700
Protein coverage (%)	TK1151 95.930 / OH-1004 65.328 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005372

Location Chr01:161933382-161937375 (-)

Description Similar to WIN1: Ethylene-responsive transcription factor WIN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15360`	Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis.	No verified direct reference in this release
`At5g11190`	Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis.	No verified direct reference in this release
`At5g25390`	Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005372 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010166 wax metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:1904278 positive regulation of wax biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G15360

ath:AT5G11190

ath:AT5G25390

zma:100282301

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.325

Rank 1 · LXL04_005372 · OH-1004

Nucleus0.309

Rank 2 · LXL04_005372 · OH-1004

Cell membrane0.193

Rank 3 · LXL04_005372 · OH-1004

Mitochondrion0.188

Rank 4 · LXL04_005372 · OH-1004

Endoplasmic reticulum0.094

Rank 5 · LXL04_005372 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI33`	Arabidopsis thaliana	Ethylene-responsive transcription factor WIN1	52.899%	Swiss-Prot	moderate database homology
`Q9LFN7`	Arabidopsis thaliana	Ethylene-responsive transcription factor SHINE 2	50.980%	Swiss-Prot	weak database homology
`Q3E958`	Arabidopsis thaliana	Ethylene-responsive transcription factor SHINE 3	46.400%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card