LXL04_005191 | RubberDandelionOmics

Gene overview

LXL04_005191

Reference: OH-1004 Chr: Chr01 Coordinates: 157469885-157472983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · LXL04_005191|LXL04_005191|OH1004|cDNA

ATGGTTGGCTGGGCGAAGCTCTTCCAGTTTCCATCCATGGCGACTTATTGCTTAACCTCAACCTCTGTACATTCACACTCTTCTTGTTCTTCCTCTCCACCCTTCTGTATATCCAAAACCAATCCCACAGACTCTCTTATTTCCTCAAACCGCTGCACGTACAGGAAAGAGACCTCCTTTCTCAACTCCTCGTTatcttcttcatcttcctctTTTATCCTCTCCCCCCGAAATCCGGTTTTCACCGTTTCAGCGCTTGT...

CDS

Download CDS FASTA

1149 bp · LXL04_005191|LXL04_005191|OH1004|CDS

ATGGTTGGCTGGGCGAAGCTCTTCCAGTTTCCATCCATGGCGACTTATTGCTTAACCTCAACCTCTGTACATTCACACTCTTCTTGTTCTTCCTCTCCACCCTTCTGTATATCCAAAACCAATCCCACAGACTCTCTTATTTCCTCAAACCGCTGCACGTACAGGAAAGAGACCTCCTTTCTCAACTCCTCGTTATCTTCTTCATCTTCCTCTTTTATCCTCTCCCCCCGAAATCCGGTTTTCACCGTTTCAGCGCTTGT...

Protein

Download Protein FASTA

382 aa · LXL04_005191|LXL04_005191|OH1004|PROTEIN

MVGWAKLFQFPSMATYCLTSTSVHSHSSCSSSPPFCISKTNPTDSLISSNRCTYRKETSFLNSSLSSSSSSFILSPRNPVFTVSALVDGEQQQYSSEPAVTGNGYSLQEDSDFRNSFKPYELYVCNLPRSCGIPELFNQFSNYGTVQSVEVSRNAETGVSKGCGHVTMSTLQEAKSAIASLDGSDMDGREMRVRFSSDMNSKWGNQSTGSRPQKNLVFESPYKVYAGNLSWSVKPEDLRNHFSRFGNVISTTVLHDRKGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005191`
TK1151 ID	TkA01G077320
OH-1004 ID	LXL04_005191
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.368 / OH-1004 77.487 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005191`
Location	Chr01:157469885-157472983 (+)
Description	Similar to 29 kDa ribonucleoprotein B, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005191` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0009451 RNA modification Biological Process GO:0045087 innate immune response Biological Process GO:1901259 chloroplast rRNA processing Biological Process GO:0009535 chloroplast thylakoid membrane Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003729 mRNA binding Molecular Function GO:0008266 poly(U) RNA binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · LXL04_005191 · OH-1004

Nucleus0.032

Rank 2 · LXL04_005191 · OH-1004

Mitochondrion0.029

Rank 3 · LXL04_005191 · OH-1004

Cytoplasm0.017

Rank 4 · LXL04_005191 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_005191 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1122-192 aa

PF00076.29RRM_1224-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005191	`PF00076.29`	RRM_1	122	192	1.2e-29	102.7
LXL04_005191	`PF00076.29`	RRM_1	224	292	1.2e-29	102.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card